Conserved Protein Domain Family
SoxG

?
pfam04268: SoxG 
Sarcosine oxidase, gamma subunit family
Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.
Statistics
?
PSSM-Id: 398107
Aligned: 2 rows
Threshold Bit Score: 321.278
Threshold Setting Gi: 81539432
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q9HTE5  53 RGDAADPAFAAAVHQALGLELPVALTLVASGETSLQWLAPDEWLLIVPGGEEYAVEQRLRQALGEELHYAVVNVSGGQTL 132 Pseudomonas aeruginosa
Q9HTE5  53 RGDAADPAFAAAVHQALGLELPVALTLVASGETSLQWLAPDEWLLIVPGGEEYAVEQRLRQALGEELHYAVVNVSGGQTL 132 Pseudomonas aeruginosa
Q9HTE5 133 LELSGANVRELLMKSTSYDVHPSNFPVGKAVGSIFAKSQCVIRHTGEDTWELVVRRSFADYFWLWLQDASAE 204 Pseudomonas aeruginosa
Q9HTE5 133 LELSGANVRELLMKSTSYDVHPSNFPVGKAVGSIFAKSQCVIRHTGEDTWELVVRRSFADYFWLWLQDASAE 204 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap