2GAG


Conserved Protein Domain Family
SoxD

?
pfam04267: SoxD 
Sarcosine oxidase, delta subunit family
Sarcosine oxidase is a hetero-tetrameric enzyme that contains both covalently bound FMN and non-covalently bound FAD and NAD(+). This enzyme catalyzes the oxidative demethylation of sarcosine to yield glycine, H2O2, and 5,10-CH2-tetrahydrofolate (H4folate) in a reaction requiring H4folate and O2.
Statistics
?
PSSM-Id: 398106
Aligned: 90 rows
Threshold Bit Score: 93.7685
Threshold Setting Gi: 123555376
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2GAG_D          4 IDCPNCGPRNENEFKYGGEAHVAypADPHALSDKQWSRYLFYRQNKKGIFAERWVHAAgCRKWFNALRDTVTYEFKAIYP 83 
WP_013148115    4 LTCPMNGTRPLSEFVFGGEYRQA--PDQDTCTDAEWAAYVHNRSGAPGDKKEWWYHSP-SGTWFIAERNTLTDKVTRTYL 80  Methylotenera ...
WP_013443135    4 LTCPVNGTRPLSEFVFGGEIRNM--PDPAQASDSAWAAYVYNRSGAPGLKKEWWYHSP-SGTWFVAERNTLTDQVARTYL 80  Methylovorus
Q1AT59          4 LNCPINGPRPIHEFIYGGEFRDM--PDVDAVTDGEWVDYLYNRSGVPGIKREWWYHVA-SNVWFIAERDTATNVVCKTYL 80  Rubrobacter xy...
jgi:Tgr7_1695   4 IPCPKVGTRPASEFVYGGLWRPM--PDPDSTTDMAWSHYVFHRDGAPGVQREWWCHAP-TGMWFVAERDTLKDEFLRTLT 80  Thioalkalivibr...
WP_023787600    4 MTCPVNGPRNISEFAWGGEIKPQ--PDPATCTDAEWTDHLFLEANTAGVVSEWWLHTP-TNTWFVARRNTVTDEVLETMT 80  Hyphomicrobium...
Q883B7          4 MTCPLNGPRNISEFTYGGEFKPM--PDPQTCSDAEWADYVFNSEDTLGVVREWWMHTP-TNYWFLAERHTGSDEIIRTFD 80  Pseudomonas sy...
Q6F9E8          4 MHCPLNGPRNISEFTYGGEFKDM--PDQNTCSDLEWADYVFNTDNIAGVVLEWWMHTP-SSYWFIAQRHTVTDEIIRTFD 80  Acinetobacter ...
WP_003118328    4 MNCPLNGPRNISEFTYGGELKAM--PDPATCSDSEWADYVFNSDNAAGVVREWWLHNA-SSYWFLAERHTVSDKIIRTFD 80  Pseudomonas
WP_013661563    4 MNCPLNGPRNISEFVYGGEVRAM--PNPATCSNEEWADYVFYSDNNVRIVKEWWYHSP-SGYWFIAERHTASDDIINTYD 80  Marinomonas me...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap