1VA6


Conserved Protein Domain Family
Glu_cys_ligase

?
pfam04262: Glu_cys_ligase 
Click on image for an interactive view with Cn3D
Glutamate-cysteine ligase
Family of bacterial f glutamate-cysteine ligases (EC:6.3.2.2) that carry out the first step of the glutathione biosynthesis pathway.
Statistics
?
PSSM-Id: 398101
Aligned: 79 rows
Threshold Bit Score: 445.035
Threshold Setting Gi: 504781207
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VA6_B         12 LEKHPQ--ALKGIQRGLERETLRVNADGTLATTGHPEALGSALTHKWITTDFAEALLEFITPVDGDIEHMLTFMRDLHRY 89  Escherichia coli
WP_013263560   18 LQNQGLapQLRQILRGLEKESLRVQPNGHLAQTQHPRALGSTLTHSSITTDYSEALTEFITPTFTDLQAPLDFLHELHQF 97  gamma proteoba...
BAM46704       11 FFKHNQaeGLETGNWGIERETHRINSDGSIALTPHPKVLATKKASQSITLDFAESQLEFMTKPHDKIEKVIDELNKIYDF 90  Amphibacillus ...
Q5E678         17 LNNEHAmnTLHDIRRGIERELIRTTPESRISNLPHPEELGSALTHPYITTDFAEAQLELVTPAMTERKTTFDSLASLHHF 96  Aliivibrio fis...
WP_012388894   17 LFANEYkdCLLSAKHGLERESVRVNEKVFLSQEPHPKFLGSSLTHPLIKTDFAEAQIEYATNIHKTIPDALAELTELHAF 96  Leptospira bif...
WP_013943394    7 LKKHKE--LLFEFQCGLERETLRISKDGKLSQKPHPIALGSPLTHPYFSTDFGEAQLEWNTPPLSSFVKAKKFLHDLMAY 84  Simkania negev...
Q8XK30         12 IKDESLedYFIKANFGLEKENVRVTESGNLALTPHPKAFGDREKNAYIKTDFSESQLEMVTPVCNTLEEVYSFICNLNKV 91  Clostridium pe...
WP_014968309   12 IQDNNLkkELLIGRFGLEKENLRVGYDGKLALTPHPKQFGQKIKNLYIKTDFSESQVEMITPAFRTLEESYNFLENLQNI 91  Gottschalkia a...
jgi:Ccel_1557  11 VINKTDskLLLNGKWGVEREAQRVNTNGCLALTDHPAAFGNKLLNNKVTTDFAESQIELITPPMSSVDEVYKFLKLLTLE 90  Ruminiclostrid...
Q97IV1         12 FSDEYRssMLSEGNFGVERESQRVNYSGDLALTPHPSVFGDKFENPRITTDFSESQIEMITPPLKSAEEVYKALNDINNE 91  Clostridium ac...
1VA6_B         90 TARNM--GDERMWPLSMPSYIAEGQDIELAQYGTSNTGRFKTLYREGLKNRYGALMQTISGVHYNFSLPMAFWQAKSGDI 167 Escherichia coli
WP_013263560   98 AYSVM--EDEKLWVNSMPCIMGPEESIPIAEYGTSNEGLFKHVYRHGLWHRYGRVMQTIAGIHYNMSYPLGFWVGFQQIL 175 gamma proteoba...
BAM46704       91 TKKQI--NDELMWPFSMPPVLPDEEDIPIARFPHLADGQDKETYREGLSVRYGKKIQMISGIHYNYSFSDQLIDQLHQAM 168 Amphibacillus ...
Q5E678         97 VATRLp-DNEIMWGASMPPELPSDDEIKIAAYGTSNAGLHKVRYREGLANRYGKRMQLISGIHYNFSLPDSFWEILHSHI 175 Aliivibrio fis...
WP_012388894   97 TARSL--EDEYLWPFSMPPALPTENKIEVGQYGTSAEGRKKTIYRNGLGHRYGKKMQTISGVHYNVSFDSCMLSVVSERR 174 Leptospira bif...
WP_013943394   85 AAQVN--SNELFWPYSMPCEL--NDNIQIARYGSSNAAREKELYRKGLCYRYGKKLQMISSLHFNFSFSQSFWDFFYDLS 160 Simkania negev...
Q8XK30         92 VSLEImkNGEFLWPQSNPPILPREEEIPIAK---LSNRE-DELYRENLSYKYGKKKQVISGIHYNFSFKEEFIKLLYKEL 167 Clostridium pe...
WP_014968309   92 VSLEL--DGELLWPQSSPSVLVDEKDIPIADFGPLDTGEKE--YRETLSKKYGKKNQLISGIHYNFSFSDKLLKKLYDEF 167 Gottschalkia a...
jgi:Ccel_1557  91 VIHEL--KSELLWPFSMPPILPSEERIPIAKYDDTPEGREKEIYRLGLANRYGKKMQMISGIHFNLSFSEGLFDTLYKYF 168 Ruminiclostrid...
Q97IV1         92 VKNAL--KGELLWPLSMPPRLPKEEDIPVAQFPDTEDGRQKQIYRNGLALRYGKKMQMISGIHYNFSFSDKMIDFIYRQL 169 Clostridium ac...
1VA6_B        168 SGad-aKEKISAGYFRVIRNYYRFGWVIPYLFGASPAISSSFLQgkptslPFEKT--ESGMYYLP--------YATSLRL 236 Escherichia coli
WP_013263560  176 QDqqplQTFISQQYFHLIRNFQRHVSIAIYLLGASPAVCGSFLRgq--khKLEPL--HKHTLIAP--------FGTSLRM 243 gamma proteoba...
BAM46704      169 APeqsrQAFINQLYMKISRNVLTYRWLITYLFGASPVVDQSYRSvf--neKMQAC--QSEWFSQTfdikeidrYATSLRT 244 Amphibacillus ...
Q5E678        176 GSelllNDFISERYFHLIRNVLRNGWIIPYLFGASPAVDKSYLInq--ehALNLL--DDETYYLP--------WATSLRL 243 Aliivibrio fis...
WP_012388894  175 FQkplsKDTKSQIYFDTIRNFYRISPALLYLFGTSSLTDVTFVDseksnkNLQKL--DAKTLNAP--------FATTLRL 244 Leptospira bif...
WP_013943394  161 GSkksmQSFINDSYFKIIRNFLCEGWLLTYLFGASPAMHESYIDk-----IPQGFtkKGNTLIHP--------DATSIRM 227 Simkania negev...
Q8XK30        168 KVekdfREFKDDIYLRMARNFQKYHWLLIYLTGASPVFHESYIEei--keEGEKL--GEDSYYIK--------DDTSLRN 235 Clostridium pe...
WP_014968309  168 GKntsfKDFKNKVYLKVTKGLLQYRWLAMYLTGASPIVHNTHDErc--inTMESN--DGENYFLK--------DNVSFRN 235 Gottschalkia a...
jgi:Ccel_1557 169 GNgenrNEFIDKSYFAMARNFLRYRWLLIYLFGASPIADITFNS------------------EIP--------NATSLRV 222 Ruminiclostrid...
Q97IV1        170 RIektkRQFIDEMYFSLTRNFLRYHWILIYLFGASPICDSTYNSvi--fkELEKI--EKCCPHCAgkiknfnrYATSLRV 245 Clostridium ac...
1VA6_B        237 SDLGYTNKSQSNLGITFNDLYEYVAGLKQAIKTPSEEYAKIGIE-KDGKRLQINSNVLQIENELYAPIRPKRVTRSGESP 315 Escherichia coli
WP_013263560  244 SDLGYHNATQKGLNISYNSLPEYVNTLYQATTTSHPDYEKIGVR-VDGQYRQLNTNILQIENEYYASIRPKRRLGHHQRT 322 gamma proteoba...
BAM46704      245 SRFGYSTAIEDKYHISYNSLTEHINDLRHVLSIDNPKYEKIGVN-KNGRRIQLNTKELQSEAEFYAPIRFRQVQKEDETL 323 Amphibacillus ...
Q5E678        244 SNMGYSSNEQSFYPTSFNSKQEYLADLCHALTTPSERYTHL-----NGD-QQLNASVLQLENELYGSIRPK-IVSDQLRP 316 Aliivibrio fis...
WP_012388894  245 SSIGYTSKVQGKYPISVNSLHEYAAGMCHVVSKTYPPYKQFNTKpTN----QLNDYILQLENEYYSLVRPKQVPKGEERV 320 Leptospira bif...
WP_013943394  228 SYLGYYSRIQDQLTISFKDLDSYLKDMKFAISTPCPLYQKIGTM-KNGEPLQINDHFLQIENEHYARIRPKRNLHKGESP 306 Simkania negev...
Q8XK30        236 SSYGYKNK--KDYYVSYNSIEEYASDIKNLV--------------KDKE--------IQSIKEYYNPIRLK--SLGSEDM 289 Clostridium pe...
WP_014968309  236 GIYGYKNK--KDYIIPYDNVENYVKTIKGLV--------------EDGE--------ISDPREFYSTVRLR--AKDNKDL 289 Gottschalkia a...
jgi:Ccel_1557 223 SQFGYSNAEQGNFIVSYNDKSEYLQNLRKLLITKSEKYSKIGTF-RDGKQIQLNENILQKDSEFYSTIRLKQVTEEGESQ 301 Ruminiclostrid...
Q97IV1        246 SRFGYSDTDEKKYTVYFNSLREYETKIKKMMETESNKYSKLGIY-KDGVQIQLNGNLLQSESEFYAPIRFKRNIKKGETQ 324 Clostridium ac...
1VA6_B        316 SDALLRGGIEYIEVRSLDINPFSPIGVDEQQVRFLDLFMVWCALADAPEMSSSELACTRVNWNRV 380 Escherichia coli
WP_013263560  323 LMALAESGVEYIEVRCLDLNPWQPVGIDADTLRFLDMFLLYCLLEPSPPISAQEYACIHKNQQTI 387 gamma proteobacterium HdN1
BAM46704      324 LDALEQRGIQYFELRLLDLNPFDKLAITKEQLQFIHLFVLYCLFEESAELTETQQMNANQNQQLV 388 Amphibacillus xylanus NBRC 15112
Q5E678        317 LYAMCHHGIQYIELRSLDNNPLLPLGISEDQSYFLDAFLTYNALAPSPELTDSERELIARRQELv 381 Aliivibrio fischeri ES114
WP_012388894  321 VDALVERGVEYLEIRLLDLDPFSAIGVEESRLYFIHMVLLYCMLNESPKADLVEMANWRKNQEQt 385 Leptospira biflexa
WP_013943394  307 LSALKTRGVEYLEVRAIDINPFDPLGLTKDQFLFLHQFLLYCLLKESSTLN-EEIRCSlignqqk 370 Simkania negevensis
Q8XK30        290 LESLLHKGIDYLEVRLLDLDPLSIQGVSKETLYLLHLFMIYTLLKENKEITYKDQEEFFKNHDMV 354 Clostridium perfringens str. 13
WP_014968309  290 LNSLLSDGISYLEIRYIDLNPFNKNGIDLETLYLIHLFILYSLIKEDEEFGEESQKVAYKNHEia 354 Gottschalkia acidurici
jgi:Ccel_1557 302 LDAIEKRGVSYAEVRILDINPFEITGISLQQMYFLQVFMLFCLFEESSYIQNNELKLVNKNHNLV 366 Ruminiclostridium cellulolyti...
Q97IV1        325 LTALVNRGVEYIEIRILDVNPFDKVGISVEQMNFLQVFNVFCLFEESKSIDEEQMERINTNHQLa 389 Clostridium acetobutylicum AT...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap