1V8D


Conserved Protein Domain Family
DUF436

?
pfam04260: DUF436 
Protein of unknown function (DUF436)
Family of bacterial proteins with undetermined function.
Statistics
?
PSSM-Id: 398099
Aligned: 116 rows
Threshold Bit Score: 217.698
Threshold Setting Gi: 313152674
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1V8D_A          47 AQRAAEEFLQAFPMAPGSLFVLGGSTSEVLGERVGTRPSLEAAHAVLEGLLPPLLERGVHVAVQACEHLNRALVVERETA 126
jgi:EAT1b_1333   8 llgFLTELHERFPLNDERILVIGCSTSEVLGKTIGKAGSNDVASELMEAFLEFREKTGVHLAFQGCEHINRALTVERRTL 87  Exiguobacteri...
jgi:Exig_2694   10 LEASLTELNERFPLK-GKLLVIGCSTSEVIGKQIGKAGSPEVAEALFDVFDTFRRSHQVDLAFQGCEHINRALTLERQIV 88  Exiguobacteri...
BAK17805        11 LAQALSEFEQQVKFSEGQLFVIGCSTSEVMGEKIGTAGAFDVAQVLYKEFSIFAQRHKIHLVFQGCEHINRALTLEAAAA 90  Solibacillus ...
BAH18474         4 LKQLMTELEAKDFFKEGQLCVIGCSTSEVIGEKIGTHSSDEVAAQFIEIFDDVHNRTGVDFCFQGCEHINRALTMERDVM 83  Macrococcus c...
Q5HMA9           4 LQQLLDELKDMSFFNPGEMCIVGCSTSEVIGKRIGSVGSMDVAKEIYENLKQLEIDTGVTFAFQGCEHINRAVTIERANF 83  Staphylococcu...
jgi:Bsel_3167   10 LIKGLDALQDQADLKPGDLLVAGVSTSEVRGAKIGSDGTLDVAEALWDGFAAFAGKTGVSLAFQGCEHINRAVTVTRETA 89  [Bacillus] se...
WP_013490640    10 VKTVLDDLQEVAKLEEGQLLVVGTSTSEVIGKHIGSAGTVDAAAEIWTALHDFAEKTGVDLAFQCCEHLNRALVIQGNVA 89  Bacillus cell...
Q9K6G3           8 LETVLGDLQKAKPLSSKHLLVIGVSTSEVAGKQIGTNSSKDVAAALYAALFSYQQKTGVALAFQCCEHLNRALVMERDEA 87  Bacillus halo...
WP_012960714    12 LTQVLHDLQAMMPLTHDHLLVIGTSTSEVAGEHIGSNGSRDIAEAIYDALSRFQDETGVKLAFQCCEHLNRALVLDGSTA 91  Bacillus pseu...
1V8D_A         127 RAFGKEEVAVFPHPKAGGAKATAAFLRFRDPVMVESLkaQAHGGMDIGGVLIGMHLRPVAVPLRLSVRKIGEAVLLAAKT 206
jgi:EAT1b_1333  88 KQFGLTEVTVVPVRSAGGAMSEKAYANFEEPCVVESI--QADAGIDIGSTLIGMHLKPVAIPVRLSSKHLGEAYVTFAVT 165 Exiguobacteri...
jgi:Exig_2694   89 ERLGLEAVTVVPVPEAGGSMASVAYQRFSAPVVVEAI--QADAGIDIGDTFIGMHLKHVAIPVRLPHREIGEAHVTAAVT 166 Exiguobacteri...
BAK17805        91 KMYHLEPVSVIPVRTAGGTMSAYAFTQMDEPVIVETI--QAHYGIDIGQTLIGMHLKAVAVPLRTSVKQLGDAVITLATT 168 Solibacillus ...
BAH18474        84 LRYRLDEVTVVPVKQAGGSMSAAAYRHFKDAVVVEHV--QADCGIDIGQTLIGMHIKHVQIPIRTTTKKVGEAVVTIATH 161 Macrococcus c...
Q5HMA9          84 NPLTMEEVTVVPDVHAGGSLSTYAYQQMEDPIVVEHI--TVSKGIDIGQTLIGMHIKHVCVPVRTSVKQIGEAIVTIATS 161 Staphylococcu...
jgi:Bsel_3167   90 VRLGLEPVTVVPVAKAGGSMAALAYRKMHDPVVVEEV--KADAGIDIGDTFIGMQLKHVAVPVRTGITAIGEAHVTFART 167 [Bacillus] se...
WP_013490640    90 DKYGYERVSAIPIPSAGGSMAAFAFENMTSPVLVEEI--KADAGIDIGDTLIGMHLKRVAVPVRSKIKTIGEAHMTMATT 167 Bacillus cell...
Q9K6G3          88 EARGYEEVAVIPVRKAGGAMATYAFTQFRDPVIVEQI--RADAGIDIGDTFIGMHLKRVAVPVRSSISAIGDAHVTMAYS 165 Bacillus halo...
WP_012960714    92 RERGYEPVSAIPIRAAGGAMATHAFSRMDNPVLVESI--KADAGIDIGDTFIGMHLKEVAVPIRSQIKEIGHAHVTIAKT 169 Bacillus pseu...
1V8D_A         207 RPKLVGGARAVY 218
jgi:EAT1b_1333 166 RPKLIGGPRAQY 177 Exiguobacterium sp. AT1b
jgi:Exig_2694  167 RPKLIGGARAKY 178 Exiguobacterium sibiricum 255-15
BAK17805       169 RPKLIGGERAQY 180 Solibacillus silvestris StLB046
BAH18474       162 RPKLIGGPRAQY 173 Macrococcus caseolyticus JCSC5402
Q5HMA9         162 RPKKIGGERAKY 173 Staphylococcus epidermidis RP62A
jgi:Bsel_3167  168 RPKLIGGARAVY 179 [Bacillus] selenitireducens MLS10
WP_013490640   168 RPKLIGGERAIY 179 Bacillus cellulosilyticus
Q9K6G3         166 RPKLIGGVRANY 177 Bacillus halodurans C-125
WP_012960714   170 RPKLIGGIRANY 181 Bacillus pseudofirmus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap