1W36


Conserved Protein Domain Family
Exonuc_V_gamma

?
pfam04257: Exonuc_V_gamma 
Click on image for an interactive view with Cn3D
Exodeoxyribonuclease V, gamma subunit
The Exodeoxyribonuclease V enzyme is a multi-subunit enzyme comprised of the proteins RecB, RecC (this family) and RecD. This enzyme plays an important role in homologous genetic recombination, repair of double strand DNA breaks resistance to UV irradiation and chemical DNA-damage. The enzyme (EC:3.1.11.5) catalyzes ssDNA or dsDNA-dependent ATP hydrolysis, hydrolysis of ssDNA or dsDNA and unwinding of dsDNA. This family consists of two AAA domains.
Statistics
?
PSSM-Id: 398098
Aligned: 55 rows
Threshold Bit Score: 458.242
Threshold Setting Gi: 122285397
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1W36_C          1 MLRVYHSNRLDVLEALMEFIVErERLDDPFEP---EMILVQSTGMAQWLQMTLS--QKFGIAANIDF-PLPASFIWDMFV 74   Escherichia coli
P57528          1 MFTIYKSNSLNTLLLKAYHIIEeKPFSNIFEK---EIFIYDNKVLFQYLNIFIA--EKKGISANFKF-YHPNDFIWKLFK 74   Buchnera aphi...
Q89AB4          1 MFTLYKSLKFNLFVKSAFKVILnEPLLNPLTK---EIFIVNNKETEQWIKIFIA--KKYKVCTNIKF-FKLKHFILNILK 74   Buchnera aphi...
Q057F6          1 MLKIYQSNKINFLLKKICKKIYiKKKKKILIN---EIFLIENKYVQKWLELYIA--NKKKINFNIKF-ILLFRFLNNFFK 74   Buchnera aphi...
Q8D2T9          1 MIYIYQSNQIDLIQKILSKILKnFPINNPMKK---EIIITSSSNISEWLKLNIT--LNINILANVEF-ISLNSFIWKLVI 74   Wigglesworthi...
Q6MFB7         37 DLEVFFSNQLSILYEQLKNNLFgFKQT-PFKK---RLVIVYGPAMQTWLTLKMAqdPDLGIAAGIEF-LYLNQAFETLIH 111  Candidatus Pr...
Q8F7I0          2 SITHITSLSLEDITSELSQNILkERKNFPLRS---ITIVVPSVNMRSWLNLNLA--RISGLCANLRF-LFLEKALEEYFH 75   Leptospira in...
Q6FF17          2 AIHVIQSQRIDVLLQGVWQSVH-QPTRQPFDVlatQHFIVPSPAVEQWLTEKLS--ELQGITANYLFhQRIRGFQWYAYQ 78   Acinetobacter...
WP_012030598    1 MFRITQATDLAHLMPDFLTALHdYPDD-IFAE---TEIVVPSMAIADYLEHHIA--EKMGISCRHRY-RFWGEMEWTIIE 73   Dichelobacter...
Q46K44          1 MLTIYRSNKAEWLAEILGQELRlNPPE-ITEE---VNIIVSTWPSSRWLSEKLS--IINNINALVKY-PFPGTYLKRLVK 73   Prochlorococc...
1W36_C         75 RV-LPEi-----pK----ES-AFNKQSMSWKLMTLlp-------qLLERed--ftLLRHYL-------------TDDSDK 121  Escherichia coli
P57528         75 II-LSKk-----eL----KN-IFTHSMIIWEIIKI----------LDNK------KFFENC-------------SKKKDM 114  Buchnera aphi...
Q89AB4         75 QN-TPKl-----yS----KS-EFSKYSIMWKIINIp--------dI-QH------LLTKIV-------------SKNNTY 115  Buchnera aphi...
Q057F6         75 KNnIKKn------K----KLiIFEKKYLQWIIILIi-----------YNtyd-csFLKKYGi------------------ 114  Buchnera aphi...
Q8D2T9         75 LT-TKNv-----pF----DN-FAFRLMLSWYIAQIip-------kINKN------IKIKNV-------------YKNLNQ 117  Wigglesworthi...
Q6MFB7        112 YFqLKNekipsilE----LSlAIEKELLT--VLQDyh-------rLSDEeqqdwlTLIYYLklnskqvgenlklTRKMEK 178  Candidatus Pr...
Q8F7I0         76 FR-AGL-------DydpfQRtFPSQDAIQRKILTFl---------IENLnseetkFLGSFLes----------------- 121  Leptospira in...
Q6FF17         79 QV-LSE-------HkddvRKaNIPRLILKWRVYQAlydfiqpdqiLITQdhpaysIIARIY-------------DSADRL 137  Acinetobacter...
WP_012030598   74 RL-----------SnrsaAQtPLSTTAIHWQLFSWlyah---raeILADedhvlaPLLHYLla---------psSARDEQ 130  Dichelobacter...
Q46K44         74 RI-IGIdp----dE----KD-PWEKNQLVWNILELlp-------eLMKVee--aqVIRSWL-------------EISDKK 121  Prochlorococc...
1W36_C        122 -----------RKLFQLSSKAADLFDQYLVYR--------------PDWLAQWETG------------------HLVEGL 158  Escherichia coli
P57528        115 -----------IKKFKFSFLMASIFKKYILYR--------------PEWINQWEIE------------------KNISIF 151  Buchnera aphi...
Q89AB4        116 -----------STLFKIASSISNLFQLYLKYR--------------PDYIKKWEQK------------------SNIPKT 152  Buchnera aphi...
Q057F6        115 ----------qYKNFEFCSHIANIFIQYIYFQ--------------PHLIYEWENN------------------KKSKKK 152  Buchnera aphi...
Q8D2T9        118 -----------FQIFYLSYKLSELYNKYLIFK--------------PDWIDLLNFK------------------KKSKKL 154  Wigglesworthi...
Q6MFB7        179 ------------RLTGLSYHLAKIFQEYGKYA--------------YSLVSKWEKS------------------------ 208  Candidatus Pr...
Q8F7I0        122 ----------iPRAFSLSAKLTSLYKDYELNR--------------SSWIQSWANEkgldip------sishrpTPFPKE 171  Leptospira in...
Q6FF17        138 engfekqlkkqKMLYWVAEQVSQLFSNYMIYRghcqkncagncgcaSNWLSAWGENreldieqlivqgnkeisaFQLQQA 217  Acinetobacter...
WP_012030598  131 t---------lPRLWQFSGEQAQLFTHYLKMR--------------PDWLLTWQQKpdc------------hleDIIATL 175  Dichelobacter...
Q46K44        122 dtq------inLKLWDLANNIAETFDDYILYR--------------PEIIKQWLSKkmk-------------kkSREISV 168  Prochlorococc...
1W36_C        159 GEAQA-W-----------QAPLWKALVEYTHQLGQPRWHranlyqrF--IETLES--ATTCPPGLPS-RVFICGISALPP 221  Escherichia coli
P57528        152 DKNEQ-W-----------QIKLWMEIIHNTKKINQSSDHfan--lfYniQKIIKE--KKIKKKYLPK-RFFIISSFSMNP 214  Buchnera aphi...
Q89AB4        153 RLKQK-W-----------QQIIWMRIIKYTKDANKPILHfsn--llYdsIKKMQR--NNFINTKLPV-RIFIFNITPITP 215  Buchnera aphi...
Q057F6        153 EKKTYqW-----------QKKLWNLIIKKIKMLKCNNFTei-------iSNFIKKieKKKKLKKIPK-KIFILSNQNINI 213  Buchnera aphi...
Q8D2T9        155 EDSQY-F-----------QLIIWNLLVKKIKKEKDFCISsiy----escIQKIEK--SNLIFEDIAD-RIFIFGIYYIPE 215  Wigglesworthi...
Q6MFB7        209 --EHRgW-----------QSRLWKSLFGGNQGWTYWTKA------------------FQKTLKFFPEcEVHFFSISFISK 257  Candidatus Pr...
Q8F7I0        172 DEYYL-F-----------QKKLYQKVFLNSNQPSTLIQFflk--evF------------KNPRRSPQdSLHLFCLSNLAD 225  Leptospira in...
Q6FF17        218 QELEA-W-----------QRWLWHRYFHQDFLDIQNIDDl-----fWqvLEQPQT--RDIALKRLPK-QIVMFTLLDLPP 277  Acinetobacter...
WP_012030598  176 PEMPT-WlrqhydgvftvQKYLWQQLFAEAMEHRQQRI-----------EQFYHRlsVDDALPALPA-RLFVFHPFSLTD 242  Dichelobacter...
Q46K44        169 NKNIL-W-----------QEILFNLLYKKINKDPFCIQVek-------aIKRLKK--DDISKLDYPK-NLYVYGLSSLAP 226  Prochlorococc...
1W36_C        222 VYLQALQALGKH--IEIHLLFTNPCRYYWGDIKD--PAYLAKlltrqrrhsfedr-elplfrdsenagqLFNSDGEQDVG 296  Escherichia coli
P57528        215 SYIKIFQNISIY--TDIYFLYITPFKKNIFNFIQ--DNKIFT---------------------------DIKIEKKNILN 263  Buchnera aphi...
Q89AB4        216 QYAIFLKSISKY--CSVHFFYATASYN---------DKQMFSts------------------------fIKFKQTQEISN 260  Buchnera aphi...
Q057F6        214 LMYFILFSIKHI--TKIYLFEFNPLD----------RKKNKT-------------------------------------- 243  Buchnera aphi...
Q8D2T9        216 IYLKILKTLSKK--IDIHLFCINPCCLYWFDIDNrfYISNLIenk----------------------ikNKKNFFRKKIK 271  Wigglesworthi...
Q6MFB7        258 AEFQFLSKLANV--APIYYYLLSPCAVFWSDIRSdnETRYLQtywq--------------------qklGSKASQVLQLE 315  Candidatus Pr...
Q8F7I0        226 TYLGILESISKKdkLPIYLYQFHTGASTKTESLG--PQRWSN--------------------------------PQIHIS 271  Leptospira in...
Q6FF17        278 SQLQFLRRLGQY--LDVLILHYNPSQEYWADSVDplWKQRYDvrvkqrfieknpaatdvdiaqffeqftLHFNAEARESR 355  Acinetobacter...
WP_012030598  243 HMLHWLQAFGQR--CEVHLWLALVSNGYFPDIVDerWRQSHT-----------------------------NADEHFRSG 291  Dichelobacter...
Q46K44        227 LQIDLIQAFSKV--INIKIYIISPCNDLWQRCEA--RRLQFRnt-----------------------wnTPPDRQWLLES 279  Prochlorococc...
1W36_C        297 ------NPLLASWGKLGRDYIYLLSDLe------------------------sSQELDAFV-------DVTPDN-LLHNI 338  Escherichia coli
P57528        264 ------DSLITLWGQYEEIYYFYILKSk------------------------kNKVINCFK-------KNKNKS-LLSQI 305  Buchnera aphi...
Q89AB4        261 ------NQLLSLLHSKNKNIIYHEIENfqkntkfqsywityeyeqmlflslikDKTINLNF-------KIKQNS-LLQYL 326  Buchnera aphi...
Q057F6        244 ------KKIINYFQKKFQYIKNPIKENi------------------------kIKKKYFFY-------KNNKKK-ILSYL 285  Buchnera aphi...
Q8D2T9        272 ------ISLLSFWGCLGAKYLKLLNNLn------------------------eNIENKIFY-------KPKKDN-LLHTI 313  Wigglesworthi...
Q6MFB7        316 ellrdrNPLLANFGKLGREMAYQIEESqatthagy----------ilpshvseLNDEIFFQedlflkeSLQPLT-LLHAI 384  Candidatus Pr...
Q8F7I0        272 ------SKIVSIPGTISKNLED----------------------------------TRIY--------PEKLSA-LKNLL 302  Leptospira in...
Q6FF17        356 ------HPLLTRLGKQARDHFSLLANLstg---------------------eeGRWVDAFV-------DDFPDT-LLGQV 400  Acinetobacter...
WP_012030598  292 ------HVLVSRFGKQQRDIFRLCQSH---------------------------NLLEEIQhitphsaDTAQQS-LLQRL 337  Dichelobacter...
Q46K44        280 ------PRLEAFLGRMGAEYQQLLEGSgeyq-------------------lgdRNEEDIFSltadiatNKGNKPnLLEQL 334  Prochlorococc...
1W36_C        339 QSDILElenravagvnieEFSRSDNKRP--LDPLDSSITFHVCHSPQREVEVLHDRLLAMLEED----PtLTPRDIIVMV 412  Escherichia coli
P57528        306 KNNFFN------------DSEFTRKKRF--LEISDHSISINICFNKKNEIEVLYEKLLIFLNEN----SsIKPGDIVVTS 367  Buchnera aphi...
Q89AB4        327 QNKILNlhsi-----qkkNNEQENNKIL--ILKTDKSLSIHSCHTLIREIEVLHNNLLNILNDN----NdILFQDVLVIS 395  Buchnera aphi...
Q057F6        286 KNDILKk-----------KIYKINSKKK--ININDNSISINQCKSYIHEVQIVNNYIHKTLETN----KkIKLDDILITA 348  Buchnera aphi...
Q8D2T9        314 QNDILYnkyyni-iiskkFNKFEKKNLRv-LNSKDNSITIHTCKNKYEEINSLYNFIVKITKDN----KkICFKDILVMA 387  Wigglesworthi...
Q6MFB7        385 QADILM-------------MRNPEGKPPfnFERKDDSIQLHIAPSIRREIQILYHNLLKLFEKD----StLQPNDIIVMA 447  Candidatus Pr...
Q8F7I0        303 KGEIRG------------------HNVE--NFSGDFSVRFWNAPSSYREIESVANDILYKMNQD----RtLTYLDFAVLV 358  Leptospira in...
Q6FF17        401 QSDILN------------LAEPQAGRYT--LEPSDESIRFHVCHSSLRQLEVLRDQLIHWLSQNddasV-RRPNDILVVV 465  Acinetobacter...
WP_012030598  338 QADMRA-------------LDDQSSLTAapLVPNDDSIRIHGCHGLLRQLELLREELVRWLNAD----EtRQLSDILIVL 400  Dichelobacter...
Q46K44        335 QQELLS--------------TKSENILT--KEKSDKSLLFLKSPGKYRQVELIRDHILQLFSDD----IkIQPRDILIMT 394  Prochlorococc...
1W36_C        413 ADIDSYSPFIQAVFgs----------apADRYLPYAISD---RRARQSHPVLEAFISLLSLpd-sRFVSEDVLALLDVPV 478  Escherichia coli
P57528        368 FSLDTYISSINLIFqs----------idNKKTIPFFIAK---KSSKTTEIMLWSFKKILNLsn-sRFENEEILELLDVPE 433  Buchnera aphi...
Q89AB4        396 KNLDTYIPYINQIFns----------asSKNFIPFSI-N---YKNIKNIEFYKTILELIDLpn-iELNINKITNLLNIPT 460  Buchnera aphi...
Q057F6        349 SNIDIYIPYIQKIFnf-----------sQNKNLLIKKTG---KEEEKKKEILLTIKDLLNIkn-nYFKPFWILSLLNIKI 413  Buchnera aphi...
Q8D2T9        388 SNIEDYSSYINSIFn------------nINYKINYFISD---IKIYERFNIISAIFNILKLpk-fKFSIEQIFYLLEFSS 451  Wigglesworthi...
Q6MFB7        448 PQISDYVPYIQSVFg------------lEESQLDFQILD---LGMQAQSEIVQGFFQLIRLse-sRWEVSELLQLFGHRL 511  Candidatus Pr...
Q8F7I0        359 TDMKVYRPAVEWVFdggillqtkvdadpIRKKIPYSLTD---INANEASLLYRGLMNFWEIcsgnFVRKNDLLKLLRNPL 435  Leptospira in...
Q6FF17        466 PNIKEIEPLIRSVFpat--------psdDGVFLPIKISGvvqLDVMNAWRAVLGRMTLLQG----RLSYDDFADWLSLPA 533  Acinetobacter...
WP_012030598  401 PELESVQDVIRTVFpas--------gdyDGAVLPARLTGiidSSAQRLWQAISGIYVLat----tPFNRHTFLQWVLQEE 468  Dichelobacter...
Q46K44        395 PQVDSYAPIITSVFnni---------dkNTTQLPWVITD---KSQEDKVGLIHFVLNLFEIsv-sRLTASIFENLLINPA 461  Prochlorococc...
1W36_C        479 LAARFDITEEGLRYLRQWVNESGIRWGIDDDNVREl-----ELP----ATGQHTWRFGLTRMLLGYAMEs----AQGE-- 543  Escherichia coli
P57528        434 IAEKFNFSEEEIKILYHWIEETNIRWGINEKHKNYl-----LFP----KNKQNTWFYGIEKLLLSYAMNd----TEKI-- 498  Buchnera aphi...
Q89AB4        461 LLKKVQINEQEIPILLQIINQTEIQWENDNILSND------WLS----NDITKCWEHGLQRIFLGQIINn---iDYKF-- 525  Buchnera aphi...
Q057F6        414 LRKKFSIKNRDIKTLGKLISHLNIAFGFNKKHYKEfs---------ipDLKTYSWEYAIKRITSGFIFNn----KNTI-- 478  Buchnera aphi...
Q8D2T9        452 ISNKFKMKEDEIKMLKYLVINLGVQWGISNKRFKKcn---------anFEEKYSWNNIIKKTVSEYYTRi----NNKV-- 516  Wigglesworthi...
Q6MFB7        512 FQRCHQLTQSDYYLIQEWIQQAGIRWGEDWLHRNEllqrhhCEKemvdSSSVGTWNFGLTRLLLGLTTVvksadSHSF-- 589  Candidatus Pr...
Q8F7I0        436 LQKKIRIHSEDVQELEKLIETSGVRYEESGR-----------------ENDTFQISNGLKRIRLSSILS-----QEAAwt 493  Leptospira in...
Q6FF17        534 TQVCYDLEDSQIKRMLALLAGAGFKRGFDIHHLQQsl---sAED----HDDRYSFKFALDRLALGIAIP-----EHTL-- 599  Acinetobacter...
WP_012030598  469 VCTAYGIADKAMQRTCDQLIAAGFYRGFEQQDLET------VAD----GDARFTLSYALERLLSGLAMPq----ADIW-- 532  Dichelobacter...
Q46K44        462 LRTQQNISIDEVSDIIKSLQSAGFTWGLDSSERY--------------GEETHSLCWCLERFLLGLVLPd---nPING-- 522  Prochlorococc...
1W36_C        544 --WQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGL----AQE-RPLEEWLPVCRDMLNAFF---LPDAETEAA---MT 610  Escherichia coli
P57528        499 --WNGVLSCSFINGSRSELIGKLISFIKILEKWQKKL----SKL-QYLTYWRSLYSDLVSDFF---QNNTKIEKS---IQ 565  Buchnera aphi...
Q89AB4        526 --WENIVPYNEFSTLYYNIFNKLISLISLLNKWKKIL----SKP-KFLSHWDITFKKLLNDFF------TDHEQKqpeAK 592  Buchnera aphi...
Q057F6        479 --YNNIYTYNISNDKKNILLGNFINFIKQLNKLRKKI----YKK-KKIEKWINIISIIIKNFF---YIEKKDKKF---FF 545  Buchnera aphi...
Q8D2T9        517 --YFKYIYSNDLDEKKINSLIKLENFISKLNYWYDYL----SQP-HLLYEWNDVIKKIIKNFF---DPDKKENYV---LD 583  Wigglesworthi...
Q6MFB7        590 ----DSIPCEGIDFSQAELMERWIRLLHSLRDDLSPLh--dRSQ-MCMEEWSCYLSCLLDTYFkceFEDSQSIAD---YE 659  Candidatus Pr...
Q8F7I0        494 kyKISQIPL-ESEEYSLHLTLFWETVLKVKKDILSFFa--nETI-RWTSEYLKVVQTSIEELF---EFSEEYEQE---AK 563  Leptospira in...
Q6FF17        600 --FQGVLSYSGVTPDDFELIGKLIQIYQDIDARRNWVlaheQGTqHSVEDWLKILMQDVIEFEqagVVALKTAREiikKQ 677  Acinetobacter...
WP_012030598  533 --LENIVPEHNIRNDDAAALAVLAQIHQQISTIRVQQ----KNH-TTAQFWLDELRQRLEHDFsafQTTAAWQLIaqtLT 605  Dichelobacter...
Q46K44        523 --ISHISPY--SENISSAEFTKAWSILSKLCNYIDAI----RSK-RSCKEWIKLITSLVKDLF---GDGGEWAWE---EQ 587  Prochlorococc...
1W36_C        611 LIEQQWQAI-IAEGLGAQYGDA-VPLSLLRDELAQRLDQERISq-RFLAGPVNICTLMPMRSIPFKVVCLLGMNDGVYPR 687  Escherichia coli
P57528        566 IIQKKWIEI-IDDSLSSNYLKK-ISINILKKIFFYKYYDNNHE--IFLPGVVNFCYPDSVCYIPFKVICMIGTDHTSIPK 641  Buchnera aphi...
Q89AB4        593 LIIKKWTEI-IHSGMQEKYTKK-ISITLLKNELCNSVSYISQSn-YLFSGKITFCNNFTLTNIPFKIIYLIGLNDNISSN 669  Buchnera aphi...
Q057F6        546 LLKNIWKKN-IFYGIKINFLKk-ISIEFFINEFFKNHSLLYKKn-QFLSGNIKLINLNKINLIPFKVICILGCTQEKISL 622  Buchnera aphi...
Q8D2T9        584 LLKKNWNDI-IFQGINTKYKKT-IYIETLENILYKRFKKENFFk-KNKFNSIHFCNLKLSKIIPSKIICLLGINDGTYPR 660  Wigglesworthi...
Q6MFB7        660 ELKSQFKLL-GDSAKTFKETK--FSFQTIKFHLNNLLQQRGITyrESHLQTIRFCSMMPLRSIPAKVIAVLGMQEGAFPR 736  Candidatus Pr...
Q8F7I0        564 LFHSWLQSLsEWEGIQLQNPE--QGISLLKFLTEQVFNQIPYRkgAYLTGGVTISLLQPMRPIPFKHIYVLGLGEGKFPG 641  Leptospira in...
Q6FF17        678 ERMVTLASF-YADKDAHTLRQIaLPLPYILDEIQRTLEHQSAQ--AEPTGQITFSQIGQIRPLPYRLVVMLNLDTGRFPN 754  Acinetobacter...
WP_012030598  606 ELTEKLQAHhQLTAAAAD---LyLPLPFILNYIGEQLSTRQVA--SEPSGVITIGRIGAMRALPYRLIAFVGADQEQFPH 680  Dichelobacter...
Q46K44        588 QLLTVVNNW-GLITDNCE---LeIDCLVVKDIITKALSSTNSKf-GHRTGKITISALEPMRAIPHKIIIIMGLESRTFPR 662  Prochlorococc...
1W36_C        688 QLAPLG-FDLMSQKPK-RGDRSRRDDDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLpgde 765  Escherichia coli
P57528        642 TNYLDN-FNLLKKYPL-IGDINLYQKYSYLFVQSLSCAEKYFYISYIGYSVKDESKVHPSILVDQLLNYITLNFCFigd- 718  Buchnera aphi...
Q89AB4        670 THESFDiYNLLKLHPR-AYDPCDEINHKNLLLKTLLSAKKFFYISHQIVSNNYKKLNNIPIAIDKIIKYITQYFYIknkn 748  Buchnera aphi...
Q057F6        623 FNNQDI-LNLIEK---------KNKNNENIFLKTIFLTKKYLFLSYIKNNYIQNK-YYPSKFILDIIFYIKNNFYY---- 687  Buchnera aphi...
Q8D2T9        661 QDINYN-FDSIYKNLK-NDDKNIRQEDLYSFLIILLSSKEHLYISFIKNYINEERSKYISIIINELIEYISVSFYIknck 738  Wigglesworthi...
Q6MFB7        737 AGYHTS-LNLMVGQDNlDYNPNSTDYDRYLFLEALQSVTDVFIVSYQGYTYQDSKVLQPSLIIEEFFTYLDKYYLIq--- 812  Candidatus Pr...
Q8F7I0        642 SDDISQ-LNLRKH-FReEWDISKREIQEFLLWETIHSAKESITFSYVGKNLQEDKTFEPCSHFLEIMEFLEVKD------ 713  Leptospira in...
Q6FF17        755 RDSHIP-FDLMDALRQqLGDRSRLEDDQGAFLDAVLLAQQALWLFYNGFDLNDGEVREPSSILQEFRDHLALIVAPaeqi 833  Acinetobacter...
WP_012030598  681 RIAEQR-HNLLTIDAPrLGDYHREHDELGSFLHALSSAGSHFWCFYTAVDPNDHEERLPAAPVQELLDYLAQNG------ 753  Dichelobacter...
Q46K44        663 IENRRS-FNLLER-KReLGDPNQYDKDRYSLLEALISTRQNLLVSWNSKDEKTGEDLEPPSPIQQWLNYLKIKL------ 734  Prochlorococc...
1W36_C        766 ---------alnCDESEARVkah-----ltCL-HTRMPFDPQNY-----------QPGERQSYA--REW 806  Escherichia coli
P57528        719 ---------qnlSYKENSKK----------ITkYLCKKHKKQFFy----------ETKNIESFI--QDD 756  Buchnera aphidicola str....
Q89AB4        749 ---------kdnFNDNLKDIksh-----iyHN-YTFYAHEKRNFl----------EKLNYPNFN--TTI 790  Buchnera aphidicola str....
Q057F6        688 ------------------------------FKkKEKKKIQKKNFlnkiykknknnIINSLFSKE--KKK 724  Buchnera aphidicola BCc
Q8D2T9        739 s------ynfleNINNIKKIlfkkynnfyfFRkEKIEIFNKKYF-------------LNNININsdkki 788  Wigglesworthia glossinid...
Q6MFB7        813 ------------NKKISEQC----------VSkHPFDAFDVSYFkpn-----silNNYSQFDYRiaEQY 854  Candidatus Protochlamydi...
Q8F7I0        714 ------------------------------VVrLPLHSYSIKYEhtl------reLKQGLVSYDfaRVW 746  Leptospira interrogans
Q6FF17        834 akhedsnltiqmQQQQFKLLdipnqlwplyCV-HPLQPFDPLGFg----------NLPVAKRYQ--DQW 889  Acinetobacter baylyi
WP_012030598  754 ------------VDQYLHYH----------LR-HQPNPFHREPY---------------RTAPA--PLW 782  Dichelobacter nodosus
Q46K44        735 ------------GDNTFKDIl---------IE-PPANPLDHFNFik--------tENSQIMSCD--RKN 771  Prochlorococcus marinus ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap