Conserved Protein Domain Family
Endonuclease_1

?
pfam04231: Endonuclease_1 
Endonuclease I
Bacterial periplasmic or secreted endonuclease I (EC:3.1.21.1) E. coli endonuclease I (EndoI) is a sequence independent endonuclease located in the periplasm. It is inhibited by different RNA species. It is thought to normally generate double strand breaks in DNA, except in the presence of high salt concentrations and RNA, when it generates single strand breaks in DNA. Its biological role is unknown. Other family members are known to be extracellular. This family also includes a non-specific, Mg2+ activated ribonuclease precursor.
Statistics
?
PSSM-Id: 398077
Aligned: 12 rows
Threshold Bit Score: 228.157
Threshold Setting Gi: 293328925
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
WP_014083916       31 TGYTLKTQLFNTINNNtns-----asSSANYG-GLWTLYTENAFRd-LYYENDNSLLDVYSEKPTGPDs--YSYTGTS-- 99  Flavobacte...
Q87FN9            294 TGYALKTALFNIINNH----------SSRGYS-AIWTLVKDADLD--NYYEKDGSILDMYSEKPAGNDa--VSFTKVT-- 356 Vibrio par...
UNSW:PCNPT3_11010 209 TSFSLKTALYNIIKNH----------QVRTYS-DVWSFISANSRD--IYYDKDHSILDMYSENPSSSDs--YYFDP-E-- 270 Psychromon...
WP_014388554       31 TGYTLKTNLRKIIDNQndgipsehisTDQGYS-GLYTTYLTSDKD--FYYENDGSLLDMYTENPTGAE---CFFTYGT-- 102 Flavobacte...
WP_011962855       30 TGYTLKTQLFNKIKAH----------TAISYSpGLWNLYYTSDVR------PDGKVWDIYSD---------CIFVFGTfa 84  Flavobacte...
WP_013870599       33 dGYALKTELKNIITSGh---------SDQGYG-GLWTAYQTTDIDntNQYDNDGFILDIYSEDPDNPEptyLNFTYSS-- 100 Lacinutrix...
CBW25729           35 sgYEFKSKLSSLLAKTh---------KGLSYS-ALLKAYKKTDKD--TTYDVDNSVMDMYSERPGGKDp--YRYIHSQ-- 98  Halobacter...
CCG54371           30 TGNNLKNQLATLITTTh--------tNQISYTpGVWNALQSGDLN----PSNSSQVLLIYGFND-------VDAIYKNdr 90  Flavobacte...
Q7MB43             29 TFEQAKVELRKRIYHD-------------QFKsGEGTFYCGCDWQ---WTGKSGGRAILSS------------------- 73  Photorhabd...
WP_011077911       26 TFEQAKVELRQKVYYD-------------RNTsEAGDLYCGCDWK---WVGRSGGRVDFAS------------------- 70  Pseudomonas
BAJ03656           19 sFSQAK-RLAKKLYSN---------------ElPSTSFYCGCDIK----IQGKKWGPDLES------------------- 59  Shewanella...
WP_014164311       31 SGYTLKTQLYNIIKDH----------TDKGYA-GLWTTYQTSDRD--KEYENDNSIIDVYSENPTGVDp--YVYQYGT-- 93  Flavobacte...
WP_014083916      100 ----QQ-CG--NYNSEGDC--YNREHTV------PQSYFGGSGSy-----------------PMYSDAHFVLPSDGKVNA 147 Flavobacte...
Q87FN9            357 ----DQ-CG--QYSQEGDC--YNREHSF------PKSWFGGKVE------------------PMNSDGHHLFATDGYVNA 403 Vibrio par...
UNSW:PCNPT3_11010 271 ----DK-CGksQVEAEGNC--YNREHSF------PKSWFGGEIS------------------PMYTDIHPLFATDGYVNS 319 Psychromon...
WP_014388554      103 ----NQdDG---TGGTAECqkYNREHII------PQSVFGSAT-------------------PMYSDAHFVTPSDKYVNA 150 Flavobacte...
WP_011962855       85 atggNQdTG---TLGSNECerYNREHTF------PKSWFGGPSGv-----------------PMYTDAFHVMPTDKHDNS 138 Flavobacte...
WP_013870599      101 ----DQ-CG--NYNSEGDC--YNREHLV------PQSSFGEAS-------------------PMKNDVHHVYPTDGYVNG 146 Lacinutrix...
CBW25729           99 ----RV-CG--SYKNEGDC--YNREHLF------PQGLFDKKR-------------------PMKTDIFHVYPTDGKVNG 144 Halobacter...
CCG54371           91 tdlsTNiCS--STCPTGS---WNREHCYalslgtPALVTSSPG-------------------P-GTDAHHIRAADVTFNA 145 Flavobacte...
Q7MB43             74 -------CGyqVRSQQNRAerIEWEHIV------PAWVFGHQRQcwrnggrkncvssdpvfrAMESDIHNLVPSIGEVNG 140 Photorhabd...
WP_011077911       71 -------CGyeVRAQENRAqrIEWEHVL------PAYAFGSQRQcwqnggrkncidtdpvfrKMEADMHNLAVSVGEVNA 137 Pseudomonas
BAJ03656           60 -------CGyqARKQEKRAerIEWEHIV------PAWALGHQRQcwheggrknctkndpifrIMEADLHNMVPAVGEVNG 126 Shewanella...
WP_014164311       94 ----NQ-CG--TYSGEGGC--YNREHMI------PQSVFNNAA-------------------PMVSDAHFIPPTDGKVNG 139 Flavobacte...
WP_014083916      148 QRNDFPYGKV-NVATWTSTNGSKlgsnLNSGYSA-GYTS-TVFEPIDEFKGDVARCLLYFVTRYQDQLSNFYSNStstak 224 Flavobacte...
Q87FN9            404 KRSNWPFGEV-GTSTYVSSNGSK----LGQASTAlGYSG-TVFEPIDEFKGDFARAYFYMATRYENVIGNWENNTsns-d 476 Vibrio par...
UNSW:PCNPT3_11010 320 RRSRFPYGET-NYPTWTSKNGSK----LGQANAStNYNG-IVFEPIDEFKGDFARAYFYMATRYENVISTWKGKDtig-s 392 Psychromon...
WP_014388554      151 QRGDLPFGVV-STATNTYSNGSKkgnnLNSGYSA-GYSS-AVFEPIDEFKGDVARMILYFGTRYETQVASWSFP------ 221 Flavobacte...
WP_011962855      139 LRGNMPYGIVgGTSSYTTNNGAK----IGICTAAnTPASlIVFEPADQYKGDVARNYFYMATCYEDKIASWQKITtdg-d 213 Flavobacte...
WP_013870599      147 GRGSFPFGIA-ASGGTSYTNGSK----KGSSLVS-GYSG-TVFEPIDEFKGDIARALLYFATRYENNVDNYTSFD----- 214 Lacinutrix...
CBW25729          145 MRGSYPFGEA-KEVRWSSKNGSK----LGYSNNP-EYKG-LVFEPIDEFKGDIARAMLYFAVRYESQIPRFGYTP----- 212 Halobacter...
CCG54371          146 DRGNRLY-----------TDGSGdagpIGASNWY----------PGDEWKGDIARMMMYMYVRYNTRCLATN-------- 196 Flavobacte...
Q7MB43            141 DRSNFSYGML----------PKNmpnnYGRCTSKvDFKS-RTFEPRDEVKGQVARINFYMHDRYNLSMSRQQ-------- 201 Photorhabd...
WP_011077911      138 DRSNFRYGVL-----------PStpmqYGACPTRtDFQQ-RVTEPRDQVKGAVARIYFYMHDRYGLSMSRAQ-------- 197 Pseudomonas
BAJ03656          127 DRSNYRFSQW-----------NAkpeqYGQCAMVvDFKS-RKVEPPSYTRGRIARTYLYMQAAYGLKIAKSQ-------- 186 Shewanella...
WP_014164311      140 MRSNYPHGMV-AVPSWTSRNGGK----LGSSAVS-GYTG-TVFEPINEFKGDIARMYFYFATRYENTVANYSSYE----- 207 Flavobacte...
WP_014083916      225 vMFDGSSNHSFSNTFLNILLTWHAS-DPVSNYEIAKNNAVYTFQGNRNPFIDHPE 278 Flavobacterium branchiophilum
Q87FN9            477 aVLDGTSTNVFEPWMLNMLKRWHKN-DPVSAKEIRRNDLVFEFQGNRNPFIDHPE 530 Vibrio parahaemolyticus
UNSW:PCNPT3_11010 393 aVLDGSKNRVFQPWVITLLKRWHAN-DPVSLKERQRNKAAFDYQGNRNPYIDHPE 446 Psychromonas sp. CNPT3
WP_014388554      222 -MFNGTSDQVFNNTFLNILLKWHMI-DPVSQREIDRNNAIYARQNNRNPYIDHPE 274 Flavobacterium indicum
WP_011962855      214 aVLDGTSDHVYENWYLNLMLKWHAQ-DPVSQKEIDRNNAVYAVQGNRNPYIDHPE 267 Flavobacterium psychrophilum
WP_013870599      215 -MFNGTNDQVFQDWAIDLLLDWHYNvDPVSQKEIDRNNAAYNFQGNANPFVDHPE 268 Lacinutrix sp. 5H-3-7-4
CBW25729          213 -MTDGSYEQTYSTWFLKTLLKWHKE-DPVSEHERKRNDAACGFQRNRNPFIDHPE 265 Halobacteriovorax marinus SJ
CCG54371          197 ---VGSGPTTYSVDMPDIFLEWNEE-DPVSPFEKTRNNVLQGIQGNRNPFIDNPy 247 Flavobacterium indicum GPTSA100-9 =...
Q7MB43            202 ---------------QQLFIAWDRQ-YPPSKWERERDNRITGIMGHHNPFVTgeq 240 Photorhabdus laumondii subsp. laumo...
WP_011077911      198 ---------------QQLLMAWDRQ-YPVSAWEQERDRRIARVMGHSNPFVTger 236 Pseudomonas
BAJ03656          187 ---------------LKLFKAWDKT-YPVDTIECKRDQAIARTQGNHNPFVKQAC 225 Shewanella violacea DSS12
WP_014164311      208 -MFNRTSNQVFAKPFLDMLLKWHAQ-DPVSAREIARNNAIYARQGNRNPFIDNPn 260 Flavobacterium columnare
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap