Conserved Protein Domain Family
Zn_peptidase

?
pfam04228: Zn_peptidase 
Putative neutral zinc metallopeptidase
Members of this family have a predicted zinc binding motif characteristic of neutral zinc metallopeptidases (Prosite:PDOC00129).
Statistics
?
PSSM-Id: 398074
Aligned: 6 rows
Threshold Bit Score: 418.841
Threshold Setting Gi: 81550574
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
rhodo:RCAP_rcc01968   1 MRWQGRHGSDNIEDRRGSDNIEDrRGGGG--------RRISLGGAGGLGLLALGLAGWifGIDLTPLLNseglHGNGMPR 72  Rhodobac...
Q9A0H5                1 MKTDDLRESQQVEDRRGQSSGSF-GGGGLggglllqlLFSRGGWKTKLVILLLLLVMG--GGGLSGVLG----GKPSSTN 73  Streptoc...
Q9CJM4                1 MRWRGRRESTNVEDRRASSGG---LGG---------------GKKTGILGIIILLIGAyyGVDLSSLVG----TPDFGMQ 58  Pasteure...
P64429                1 MRWQGRRESDNVEDRRNSSGGPS-MGGPG---------FRLPSGKGGLILLIVVLVAGyyGVDLTGLMT----GQPVSQQ 66  Escheric...
Q9RR98               22 MDWRNLPGGGNIEDRR---GGGGlPGGGL-----------AVGG--GIGGLILALIAYffGIDPSVVTGg---GQQQSPA 82  Deinococ...
Q9HV81                1 MLWRKGRRSDNVIDAR---GEGG-AGGGGgmr--iggKGLSLGG-----VAIVVVVGLlmGQDPMQILGsl-lGQMDSPA 68  Pseudomo...
rhodo:RCAP_rcc01968  73 ESAPQVQEGGALSa--RDRAMGDFVSVTLADTEEIWAGLFRnDLGRVYHPAVLVLFSQVTRSPCGTASGATGPFYCPADG 150 Rhodobac...
Q9A0H5               74 NNAYQSSQVTRTNgdkASQEQVSFVSKVFASTEDYWTKTFR-EKGLTYHKPTLVLYTGATQTACGRGQASSGPFYCPGDQ 152 Streptoc...
Q9CJM4               59 ----QSSPLASEE----EQELNSLSRVVLADTETVWGNYFA-RQQQRYQAPVMVLYNRVTHTACGTGQSAMGPFYCPNDR 129 Pasteure...
P64429               67 ----QSTRSISPN----EDEAAKFTSVILATTEDTWGQQFE-KMGKTYQQPKLVMYRGMTRTGCGAGQSIMGPFYCPADG 137 Escheric...
Q9RR98               83 QTQAQSQ-AQGGQ---AEDEDYQFADRIVASTDRTWTQIFQ-QSNRQYTKPTLVLFSRSVSSACGQASSATGPFYCPLDS 157 Deinococ...
Q9HV81               69 PATQQQAGGRAPA---ANDEQSEFVRSILGDTEDTWEQIFA-SGQAQYQQPKLVLFSNGVNSACGFASSATGPFYCPADR 144 Pseudomo...
rhodo:RCAP_rcc01968 151 KVYLDTAFFDTLSQELGAAGDFAAAYVVAHEIGHRVQDELGLLDKVEAARA-TADPATANALSVRLELQADCLAGIWAHH 229 Rhodobac...
Q9A0H5              153 KVYLDISFYNELSTKYGAKGDFAMAYVIAHEVGHHIQNELGIMDNYASARQ-GKSKAKANQLNVKLELQADYYAGAWANY 231 Streptoc...
Q9CJM4              130 KVYLDLSFYQDMKTKLGADGEAAFAYVIAHEVGHHIQNLLGILPKVHQLQG-QTSRTQANQLSVKVELQADCFAGVWAYQ 208 Pasteure...
P64429              138 TVYIDLSFYDDMKDKLGADGDFAQGYVIAHEVGHHVQKLLGIEPKVRQLQQ-NATQAEVNRLSVRMELQADCFAGVWGHS 216 Escheric...
Q9RR98              158 KLYLDTSFFNLMQRQLGGGGDFAYSYVIAHEVGHHVQNELGIAEQVERKQRaARSEAEQNSYSVRLELQADCFAGVWGNS 237 Deinococ...
Q9HV81              145 RVYLDLEFFREMEQRFSAAGDFAQAYVIAHEVGHHVQNLMGISAKINAARQrGARMEGANGLSVRQELQADCFAGVWANR 224 Pseudomo...
rhodo:RCAP_rcc01968 230 AAADFgT-LERGDVAEAMSAAARIGDDTLARNAGRRPMPDSFTHGTSDQRQFWFAQGFTTGQIASCDSF 297 Rhodobacter capsula...
Q9A0H5              232 VQGQG-L-LEKGDIEEAMAAAHAVGDDTLQEETYGRTVPDSFTHGTSKQRQRWFDRGYQYGDFEHGDTF 298 Streptococcus pyoge...
Q9CJM4              209 ASKTG-L-FETGDIEKAFNAAEAVGDDRLQKRSQGYVVPDSFTHGTSAQRLHWFKRGLNSGDPNQCNTF 275 Pasteurella multocida
P64429              217 MQQQG-V-LETGDLEEALNAAQAIGDDRLQQQSQGRVVPDSFTHGTSQQRYSWFKRGFDSGDPAQCNTF 283 Escherichia coli K-12
Q9RR98              238 VKGREaAnLTEDDVREAINTAAAIGDDTLQRQGQGMVVPDSFTHGTSQQRVNWFMRGFQTGNPNQCDTF 306 Deinococcus radiodu...
Q9HV81              225 AQQRLnW-LEPGDIEEALNAANAIGDDRLQRQGRGMVVPDSFTHGSSAQRMRWFKTGFESGSPASCDTF 292 Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap