1VKM


Conserved Protein Domain Family
Indigoidine_A

?
pfam04227: Indigoidine_A 
Click on image for an interactive view with Cn3D
Indigoidine synthase A like protein
Indigoidine is a blue pigment synthesized by Erwinia chrysanthemi implicated in pathogenicity and protection from oxidative stress. IdgA is involved in indigoidine biosynthesis, but its specific function is unknown. The recommended name for this protein is now pseudouridine-5'-phosphate glycosidase.
Statistics
?
PSSM-Id: 398073
Aligned: 247 rows
Threshold Bit Score: 243.839
Threshold Setting Gi: 159110649
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1VKM_A                    15 IESRIEKGKPVVGXETTVFVHGLPRKEAIELFRRAKEISREKGFQLAVIGILKGKIVAGXSEEELEAXXREGa-----dK 89  The...
A9NGD7                    11 VLDALRSGKPVVALESTIIAHGMPYPKNVETALNVEKIVEQNGAIPATIAIIDGRIKVGLNPNELTSLGKlsn----vlK 86  Ach...
A5IXG3                     9 VESALKHKRPVVALESTIITHGMPYPKNVEMALNVENIIRKQGAVPATIAIINGIIHVGLENDEINELAKlkd----viK 84  Myc...
WP_013361141              11 lEKIIRSNKPVVGLELNSISKVVPYPQSLNLAMEIEDIIKSSGAYPATLGIIDGKLIAGLTSSEIAYLLSmdh----apK 86  Ace...
WGS:AAFB:cds.EHI_149860A  66 VKNAMKQQLPIVALESTIISHGLPYPDNENVANEIENIIRENGAVPATIGIVEGKIHVGMSKDLISQFSQrkg----ieK 141 Ent...
B5Y6G9                     8 VKEAIETLKPVVALESTIITHGMPYPANLHTALEVEQVIKEAGAVPATIGVINGIIKVGLSEEEITYLSQakd----lhK 83  Cop...
WP_015424729              11 IKRAFDKRKPILAMESTVLTHGLPYPKNLDILKTLEELCQELDVEPATIIVLDGKIHIGMTEAEKEILQCKLesgeevgK 90  Can...
A7HMA1                     7 VKKALEDGIPVIALESTVIAHGLPYPHNVETAKMLEEMALENGVVPATIGILKGEIIVGMSQEQINEMLAde-----plK 81  Fer...
C5CDZ1                     1 -----mkkQPIVALESTVIAHGLPWPTNFETAVSMENKVKEKGAIPKTLGIINGEIKIGLTEKEIEHLAKakn----vmK 71  Kos...
B3GW58                    12 VQNALSNGLPILGLESNVLSHGLPYPRNLEMFNACDEIIRSNGVVPALTFIRDKRICIGASPKDVELLTDdpk----piK 87  Cor...
1VKM_A                    90 VGTREIPIVVAEGKNAATTVSATIFLSRRIGIEVVVTGGTGGVHP-G---RVDVSQDLTEXSSSRAVLVSSGIKSILDVE 165 The...
A9NGD7                    87 VSKRDIPYCVIKKYSGATTVSATILIADMVGIKVFATGGIGGVHK-DaaaTFDISRDLEEISEKQVAVVSAGAKAILDLD 165 Ach...
A5IXG3                    85 TSKRDFGYVLANKKNGGTTVSGTVLVAQKVGIPVFATGGIGGVHR-GaeiTFDISRDLDELSTNNVLVVCAGAKLILDLG 163 Myc...
WP_013361141              87 ISTRDISYFISQKLSGTLTSAAALFISKLAGIRVLSTAAIGGVHR-GaveNFDISSDLQELSSTNVAVVCSGVNYIFDIP 165 Ace...
WGS:AAFB:cds.EHI_149860A 142 VSVRDISGVIAKKQWGATTVAATSRIASMVGIKVFVTGGLGGVHR-NaevTMDISADLIELGSNPICVVSAGPKIILDVN 220 Ent...
B5Y6G9                    84 ISLKDLSVAAAKKLSGGTTVSATMFASYKAGIQVFATGGIGGVHR-DareSFDVSTDLEALGSIPITVVCAGAKAILDLP 162 Cop...
WP_015424729              91 FNLRDIPYAVSRKKSGGTTVSATMLIANKAGIKVFATGGIGGVHKfWn-eTLDISSDLKALAEIPVIVVSAGCKAILDIP 169 Can...
A7HMA1                    82 IGTREIPYAVGMKKSAATTVSATMRIAKIAGIDVFATGGIGGVHI-G---DWDVSQDITEMAKSDVIVVSAGCKSILDVK 157 Fer...
C5CDZ1                    72 IGTAEIAAAIALRRNAATTVSATMRLAKNAGIDVFATGGIGGVHRn---vPWDVSQDIMELSKTRMIVVCAGFKSILDVE 148 Kos...
B3GW58                    88 VSARDIALCIAQGKVGATTASASIAICELAGIRIFSTAGLGGVHRdFs-eTLDVSADLHEISSRKTIVVSAGVKKFLDIP 166 Cor...
1VKM_A                   166 ATFEXLETLEIPLVGFRTNEFPLFFSRKSGRRVP-RIENVEEVLKIYESXK-EXELE------KTLXVLNPVPEEYEIPH 237 The...
A9NGD7                   166 LTLEYLETKGVEVIGYKTSEFPAFFSNASGLNTTfQLDEASQIAQLMYTKW-NMGLS------GGIVVANPIPQNYAIDK 238 Ach...
A5IXG3                   164 LTLEYLETKGVEVLGYNSDKLPAFYSSSSEFNVTyNVHSASEVAAIMKAKW-KF-TN------GGIILANPIPEQYGLEY 235 Myc...
WP_013361141             166 LTLEYLKTYGVPVVGYTTDIFPAFYVLDDRLKVEyRIDHPKEIASLIDTKW-NLGIK------GGVIVANPVPPACVIDR 238 Ace...
WGS:AAFB:cds.EHI_149860A 221 KTVEYLETQSVSVYGYRTTTLPQFYVPNSNIHIP-SINETSTIAEIINWNR-KLHIN------KGILVTVPIPKEDALEL 292 Ent...
B5Y6G9                   163 ATLEYLETKGVLVVGYKTDEFPAFYYGRSGLKLEhSVTTPGELAQIIRERD-ALEIN------KAILVGNPPPEEMALEK 235 Cop...
WP_015424729             170 ATLEVLESYSVPVLGWKTDEFPAFYARTSG-KKIeKLESAKDVVNIYQ------TMRelyphpTGILVANPVPEKDEIPF 242 Can...
A7HMA1                   158 KTIEFLETFQVTVVGYKTNKFPIFYEGLSDFNLEhRVDSPEDIAKIFRAKK-SLGIE------GALLVANPIPQEFVISE 230 Fer...
C5CDZ1                   149 RTIEFLETFQVTVVGYQTDYMPLFHTKESEYKVNiRADSPEEIVAIFNEKE-KLGIE------GAILVANPIPEQSEIPR 221 Kos...
B3GW58                   167 KTSEVLESLGVPVVGFGTSEFPAFYCRKSGAFLEsFSQDPIEIATAAATHIeTVGPG------GFLILVAP-SKEIALDD 239 Cor...
1VKM_A                   238 DEIERLLEKIELEVE-----GKEVTPFLLKKLVEXTNGRTLKANLALLEENVKLAGEIAVK 293 Thermotoga maritima MSB8
A9NGD7                   239 DSLDKAISSAILSAKdnkitGKELTPYLLKMLHSNKDITSLESNIGLIYNNAKIAALIAVE 299 Acholeplasma laidlawii...
A5IXG3                   236 EYILDNINKAIEQAKvegisGKKTTPYLLSKVLELTEGKSLEANIQLVYNNAKVAAQVAVE 296 Mycoplasma agalactiae PG2
WP_013361141             239 ETMESYVKMALEKARqshidRKDFTSYMIEEIDSYTKGKTMQYIGEILKNNARLSCIISEE 299 Acetoanaerobium stickl...
WGS:AAFB:cds.EHI_149860A 293 DQVNKWINAALKEAEihhieGKATTPFLLNYLNTHTNSQTVRANVALIKNNAKVGASIAYE 353 Entamoeba histolytica ...
B5Y6G9                   236 GKVEQLIEAALQQAKvnnikGKDVTPFLLDYLAKNSKGETLETNIALVKNNAYVGSLIAKA 296 Coprothermobacter prot...
WP_015424729             243 AEIEKYISAAIAEAKtkniaGKELTPFLLATLAEKTKGQSVQSNLALLKNNVIIGAQIAKE 303 Candidatus Cloacimonas...
A7HMA1                   231 QEVDGYMKQALSECFekgitGKAVTPYLLSRIAQLSNGKTLTSNIELLKNNVLLACQIAKS 291 Fervidobacterium nodos...
C5CDZ1                   222 EELEEYIKKAVAQAKengisGKSLTPFLLSRLTELSGGKTLTANIALLKNNASLAGEIAVA 282 Kosmotoga olearia TBF ...
B3GW58                   240 ELVEKAVQRSLINASsqgvrGKAITKFVMRAIDSETDNRSQTANFDVMVEVVNAAAQIARS 300 Corynebacterium aurimu...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap