2HJ0


Conserved Protein Domain Family
CitF

?
pfam04223: CitF 
Citrate lyase, alpha subunit (CitF)
In citrate-utilising prokaryotes, citrate lyase EC:4.1.3.6 cleaves intracellular citrate into acetate and oxaloacetate, and is organized as a functional complex consisting of alpha, beta, and gamma subunits. The gamma subunit serves as an acyl carrier protein (ACP), and has a 2'-(5''-phosphoribosyl)-3'-dephospho-CoA prosthetic group. The citrate lyase is active only if this prosthetic group is acetylated; this acetylation is catalyzed by an acetate:SH-citrate lyase ligase. The alpha subunit substitutes citryl for the acetyl group to form citryl-S-ACP. The beta subunit completes the reaction by cleaving the citryl to yield oxaloacetate and (regenerated) acetyl-S-ACP. This family represents the alpha subunit EC:2.8.3.10.
Statistics
?
PSSM-Id: 398071
Aligned: 6 rows
Threshold Bit Score: 836.376
Threshold Setting Gi: 81537994
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HJ0_A  45 DDKLLSSIHEAIEKTRLKDGXTISFHHHFREGDYVXNXVLDEIAKXGIKDISIAPSSIANVH-EPLIDHIKNGVVTNITS 123
P75726  43 DRKLCANLEEAIRRSGLQDGMTVSFHHAFRGGDLTVNMVMDVIAKMGFKNLTLASSSLSDCH-APLVEHIRQGVVTRIYT 121 Escherichia coli K-12
Q9KTT9  66 SRKVKSSIREAIVDLGLKDGMTISFHHAFRGGDKTVNLVMEVIAELGIKNLTLASSSLTSCH-SPLIEHIKNGVVSKIYT 144 Vibrio cholerae
Q99ZK7  45 DSKLLGSVREAIEKTGLTDGMTISFHHHFREGDFIMNMVLEEIAKMGIKNLSIAPSSIANVH-EPLIDHIKNGVVTNITS 123 Streptococcus pyogene...
Q9CGA7  45 pNKLVDSLEEVVLKT-VKDGMTISFHHHFREGDYVFNKVMRIIIDHGFKDLRIAPSSLTNVMnDILVEAIEKGVVTNITS 123 Lactococcus lactis su...
P44459  33 DRKLCTSLEEAIKRSGLKDGMTVSFHHAFRGGDFVVNMVMNKIAEMGFKNLTLASSSLIDSH-FPIVEHIKNGVVTKIYS 111 Haemophilus influenza...
2HJ0_A 124 SGLRDKVGAAISEGIXENPVIIRSHGGRARAIATDDIHIDVAFLGAPSSDAYGNANGTRGKTTCGSLGYAXIDAKYADQV 203
P75726 122 SGLRGPLAEEISRGLLAEPVQIHSHGGRVHLVQSGELNIDVAFLGVPSCDEFGNANGYTGKACCGSLGYAIVDADNAKQV 201 Escherichia coli K-12
Q9KTT9 145 SGIRGALADSISNGLLDEPVHIHSHGGRVHLIQSGELYIDMAFIGVPCCDEFGNANGFKGKSNCGSLGYAKVDAEHAEKV 224 Vibrio cholerae
Q99ZK7 124 SGLRDKVGAAISEGLMENPVVIRSHGGRARAIASGDIHIDVAFLGAPSSDAYGNVNGTKGKATCGSLGYAMIDAKYADQV 203 Streptococcus pyogene...
Q9CGA7 124 SGMRGTLGDVVSHGALKNPVIFRSHGGRARAIETGEIHIDVAFLGTPNADEMGNANGMDGKAPFGSLGYALMDAQYADTV 203 Lactococcus lactis su...
P44459 112 SGLRGELAEQISRGLLNEPVNIHSHGGRVHLVKSGELKIDVAFLGVPCCDTFGNANGFTGKSKCGSLGYARVDAEYADKV 191 Haemophilus influenza...
2HJ0_A 204 VIVTDTLVPYPNTPISIPQTDVDYIVVVDAIGDPEGIAKGATRYTKNPKELLIAEYAAKVITSSPYYKEGFSFQTGTGGA 283
P75726 202 VMLTEELLPYPHNPASIEQDQVDLIVKVDRVGDAAKIGAGATRMTTNPRELLIARSAADVIVNSGYFKEGFSMQTGTGGA 281 Escherichia coli K-12
Q9KTT9 225 VMLTEAIVGFPNFPASITQDRVDAVVQVAEVGDPSKIGGDATRMTTNPRELLIAKRAAEVIEHSGYFYDGFSMQTGSGGA 304 Vibrio cholerae
Q99ZK7 204 VILTDNLVPYPNTPISIPQTDVDYVVTVDAIGDPQGIAKGATRFTKNPKELLIAEYAAKVITNSPYFKEGFSFQTGTGGA 283 Streptococcus pyogene...
Q9CGA7 204 VAITDSLVSYPNTPASIKQTQVDYVVKIDAVGNPDKIGAGATRFTKDPKELKIASMVNDVIVNSPYFKNGFSFQTGTGGA 283 Lactococcus lactis su...
P44459 192 VLLTEEFVEYPHHPISIAQDQVDLIVQVEAVGDPKKIGGGATRMTTNPRELLIARKCAEVIFASGYFKDGFSLQTGSGGA 271 Haemophilus influenza...
2HJ0_A 284 SLAVTRFXREQXIKDDIKANFALGGITNAXVELLEEGLVDKILDVQDFDHPSAVSLDRNAEkHYEIDANXYASPLSKGSV 363
P75726 282 SLAVTRFLEDKMRSRDIRADFALGGITATMVDLHEKGLIRKLLDVQSFDSHAAQSLARNPN-HIEISANQYANWGSKGAS 360 Escherichia coli K-12
Q9KTT9 305 SLAVARFLKEKMLRQDIRASFALGGITATMVDMHEQGLIDYLLDVQCFDSVAAGSLARNPH-HLEISANEYANPSSKGAA 383 Vibrio cholerae
Q99ZK7 284 SLAVTRFMREAMIKENIKASFALGGITNAMVELLEEELVEKILDVQDFDHPSAVSLGKHAE-HYEIDANMYASPLSKGAV 362 Streptococcus pyogene...
Q9CGA7 284 ALAVTRFLRQSMIDHNVKATFGLGGITKPMVDLLEEGLVDKLMDVQDFDGGSAQSMHLNKN-QQEIDASWYADPANKGAM 362 Lactococcus lactis su...
P44459 272 ALAVTRFLEEKMRRENITADFALGGITASMVALHEAGLIKKLLDVQSFDSVAAESLARNPN-HIEVSANQYANYSSKGAS 350 Haemophilus influenza...
2HJ0_A 364 INQLDICVLSALEVDTNFNVNVXTGSDGVIRGASGGHCDTAFAAKXSLVISPLVRGRIPTFVDKVNTVITPGTSVDVVVT 443
P75726 361 VDRLDVVVLSALEIDTQFNVNVLTGSDGVLRGASGGHCDTAIASALSIIVAPLVRGRIPTLVDNVLTCITPGSSVDILVT 440 Escherichia coli K-12
Q9KTT9 384 VDRLDVVILSALEIDTQFNVNVITGSDGVIRGASGGHCDTAAAANLSIIVAPLVRGRIPTVVEKVTNVITPGSTIDVLVT 463 Vibrio cholerae
Q99ZK7 363 INQLDTCILSALEVDTNFNVNVMTGSDGVIRGASGGHCDTAFAAKMSLVISPLIRGRIPTFVDEVNTVITPGTSVDVIVT 442 Streptococcus pyogene...
Q9CGA7 363 VDKLDVVILSALEIDTKFNVNVMSGSDGVIRGAIGGHQD-AGTAKLTIISAPLVRGRIATVVPDVTTVITPGDSIDVLVT 441 Lactococcus lactis su...
P44459 351 VERLDMVILSALEIDTKFNVNVLTGSDGVIRGASGGHCDTAASAQVAIIVAPLVRGRIPTVVENVITCVTPGENVDILVT 430 Haemophilus influenza...
2HJ0_A 444 EVGIAINPNRPDLIEYFKDLK-VPQLTIEELKEKAYAIVGNPQPIQYGDKIVALIEYRDGSLIDVVRNV 511
P75726 441 DHGIAVNPARPELAERLQEAG-IKVVSIEWLRERARLLTGEPQPIEFTDRVVAVVRYRDGSVIDVVHQV 508 Escherichia coli K-12
Q9KTT9 464 DQGIAVNPNRPELKARFIEAQ-LPVVEIEALQQRAELLTGKPQPLQFEDKTVAFVHYRDGSIIDVIKQV 531 Vibrio cholerae
Q99ZK7 443 EVGIAINPNRQDLVDHFKSLN-VPQFSIEELKEKAYAIVGTPERIQYGDKVVALIEYRDGSLMDVVYNV 510 Streptococcus pyogenes serotype M1
Q9CGA7 442 EIGIAINPKRTDLLDKLSNIPgLPVYTIEELQKIAEEKLGKPEPLEFTDKVVALIEYRDGSLLDIIREV 510 Lactococcus lactis subsp. lactis
P44459 431 DHGVAVNPKRPDLIEALSKTD-IPLFTIEQLCERAYSITGKPKEIEFTNKPVAVVRYRDGSVIDTVYQV 498 Haemophilus influenzae Rd KW20
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap