Conserved Protein Domain Family
MtrE

?
pfam04206: MtrE 
Tetrahydromethanopterin S-methyltransferase, subunit E
The N5-methyltetrahydromethanopterin: coenzyme M (EC:2.1.1.86) of Methanosarcina mazei Go1 is a membrane-associated, corrinoid-containing protein that uses a transmethylation reaction to drive an energy-conserving sodium ion pump.
Statistics
?
PSSM-Id: 398056
Aligned: 21 rows
Threshold Bit Score: 371.641
Threshold Setting Gi: 121707811
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q58257             8 LGALALSGALATVAGCAEDLESDVGSQSNPNSQVQLAPQMGNIHRYFNKAISGEPVSYGLYVAVAGTVAYAIM-QMGLNP 86  Methanocald...
WP_004037740       8 VGVTALAGALATVAGAAEDTESNIGSQGDPNSQVQLAPQMGYIHRIYNKAVSGEPPAYGLWVTIGAGVAWAFM-ATGMNP 86  Methanofoll...
Q2FRN6             8 IGITALAGAFATVAGAAEDTESDIGSQGDPNSQVQLAPQMGYIHRIFNKAISGEPPAYGAWCAIGAGVAWALM-QINYNP 86  Methanospir...
WP_012106112       9 IGITALAGALATVAGSAEDTESNIGSQGDPNSQVQLAPQMGFVHRIFNKAVAGEPPAYGLWCALGAGLAWAFL-AMQINA 87  Methanoregu...
ABN07724           8 IGVTALAGALAAVAGAAEDTESNIGSQGDPNSQVQLAPQMGYTHRIYNKAVSGEPPAYTLWVTLACGVAWAFL-MLGVNA 86  Methanocorp...
jgi:Mfer_0783      8 LGILALTTASAIIGQTIEDVETNIGSQSNPNSQVQLAPQMGNLHRFFNKAIAGEPFAYGTFCGVSGAITVAML-YLHLPA 86  Methanother...
NZAGRC:Abm4_1525   6 LGVVALMGAAATIGGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKATSGEPVAYGVWCGVAGAVAFVFMsYLNVMP 85  Methanobrev...
O27231             8 LGVVALMGAAATIAGAAEDLESDVGSQSNPNSQVQLAPQMGHLHRIINKAVSGEPVAYGTWCGIAGSVAYVLMqSMQLPV 87  Methanother...
Q49606             7 IGLAAAMGALATIAGAFEDAESDVGSQSNPNSQVQLAPQMMNFHRYFNKAISGEPVSYMLYGAIAGTVTWVMMtKFGLPF 86  Methanopyru...
Q6LWZ4             8 LGALALAGAAATVSGCAEDLESDVGSQSNPNSQVQLGPQMGNIHRYFNKAISGEPVSYGLYVAVAGTIAWALI-NAGLNV 86  Methanococc...
Q58257            87 ILALILGAGVAAFVHGAYAISAYLGRIVGQSKnFGQPVYWDVVMSHLGPIVGHGFIAVFCMVLMAYLANTILG----NPF 162 Methanocald...
WP_004037740      87 VLAIVIASALAIFVQGVYAATAYLGRTSSLAK-FEQPVYIDLLKSVTSVTMAHAFVAVFTTVSMCYLLNAALG----HPF 161 Methanofoll...
Q2FRN6            87 ALAIILGSVIAVFVQGIYCTSGYLGRIASLAK-FQQPVYIDIIKSLLSVTMAHAFVAIFCTVAMCYLMASALH----HPF 161 Methanospir...
WP_012106112      88 VLAIVLGSLLAVFVQGIYATTAYLGRTASLSK-FGQPVYVDILKSMTTVAMAHAFVAVFCTVTICYLINVALG----HPF 162 Methanoregu...
ABN07724          87 ILAIIFGTVLATFVQGVYATTAYLGRTASLSK-FGQPVFIDVVKSVTTVTMAHAFVAIFATVTVCYLMMTVIG----HPF 161 Methanocorp...
jgi:Mfer_0783     87 VIALAIGAAITTLIWLAYSTTAYLGRVSGSAT-FNQPVFLDMLTENLGPIAGHAFIVFFCITGVAYLMTLPVKgf-aHPF 164 Methanother...
NZAGRC:Abm4_1525  86 IVAIVLGAVVGAFVHSIYTVTSHMGRIVGQSQ-FGQPLFMDVLTECLGPIAGHGFIATFCIVGMSYLMIIPINgsalHIF 164 Methanobrev...
O27231            88 IMAIAVGAVIAAMVHTTYAVTSHMGRIVSQSQ-FNQPLFMDMLVQHLGPIAGHGFIVTFCIVGLSYLMTLPIPgf-aHPF 165 Methanother...
Q49606            87 LAAAAVGVGVNALIHMVFATTAHLGRMASAAE-FGHPIYLDVVLSHLGPIAGFGGIATFAIVSLAYIQWALLK----HPF 161 Methanopyru...
Q6LWZ4            87 VLAIIVGAGVAAIVHGAYSVSAFLGRTVGQSKkFGQPVYMDVLTSHIGPIVGHGFIAVFTMTLAAYLATTALG----NPF 162 Methanococc...
Q58257           163 PLPLIALIFGITVGAIGSSTGDVHYGAEREYQKYPFGGGVPVANHGDIDIKAEYGLRNGMDSSYFCSRLGGVLTGLCFGL 242 Methanocald...
WP_004037740     162 PLPLLGIVWGIALGAAGSATGNPFYGKERQYQSQMFGAGVPISASGNIVRYAEAGQRSSLDNGWFTAKLGGPASGVCFGL 241 Methanofoll...
Q2FRN6           162 ALPLLGLVWGIALGAAGSATGNPFYGKERQYQNQKYGAGVPISASGNIVRYAEAGQRSSLDNGWFTTKFAGPASGICFGL 241 Methanospir...
WP_012106112     163 PLPLLGFIWGITLGAAGSATGNPYYGKERQYQNQKFGAGVPISASGNIVRYAEAGERNSIDNGFFTAKFGGPASGLCFGL 242 Methanoregu...
ABN07724         162 ALPLLGIVWGLALGAAGSATGNPYYGKERQYQNQKFGAGVPISASGNIVRYAEAGQRSSIDNGFFTAKFGGPASGLCFGL 241 Methanocorp...
jgi:Mfer_0783    165 PIPVIGMIWGMTIGAIGSAVGDVYYGAEAEFVHKKFGGGIPVASHGDITRKGVLGARSPMEVGNFTVKYGSPITGMAFGL 244 Methanother...
NZAGRC:Abm4_1525 165 PLPILAVLWGITIGAIGSSTGDVYYGSESEYQKFAYGAGTPVAIQGDIVTKEAIGAKNSIDVVGFCSRFGGPITGLCFGL 244 Methanobrev...
O27231           166 PLPLLAVLWGITIGAIGSSTGDVHYGAEREYQQYPFGGGIPVAIHGDITTKAELGARNSMDVVHFCAKYGGPLTGFAFGA 245 Methanother...
Q49606           162 PLPLLAALWGVTVGAIGSSTGDVHYGAERLYQHYPFGGGVPVAAHGNITRKAETGIRNSMDSVYFCAKFGNPLTGLCFGL 241 Methanopyru...
Q6LWZ4           163 PLPLVSLIFGITVGAIGSSTGDVHYGAEREYQKYPFGGGIPVANQGDIDIYAEYGVRNGLDSSYFCSRFGGPLTGLCFGL 242 Methanococc...
Q58257           243 IVFLDGWRGVLGDILkggqggsviTASIISIVI-GLIIVAILAIIN 287 Methanocaldococcus jannaschii DSM 2661
WP_004037740     242 IVFLELWRTVLFEEA---------VGGWGAIIV-GVIIILIFMIId 277 Methanofollis liminatans
Q2FRN6           242 IVFLELWRTVLFEKM---------MGGWGAIIM-GVVLILVFtfid 277 Methanospirillum hungatei JF-1
WP_012106112     243 IVFLELWRTILFDKI---------GAGWGAIIV-GVLIILVFtvvd 278 Methanoregula boonei
ABN07724         242 IVFFELWRTIIFEDF---------LAGWGAVIV-GAVVIIVFMIid 277 Methanocorpusculum labreanum Z
jgi:Mfer_0783    245 IVLFTFWFDIVFEKW--------------SILA-AFLFVILLIVIN 275 Methanothermus fervidus DSM 2088
NZAGRC:Abm4_1525 245 IVFLSFWITIVFGTI-------------GGQIA-GIIIVLLLIYLN 276 Methanobrevibacter sp. AbM4
O27231           246 IVFLSFWNTIVFGIT-------------GGIIS-GLIIVLLLIILN 277 Methanothermobacter thermautotrophicus str. D...
Q49606           242 VVFFSTWAGLFGQ--------------WGAVIAmGLVTLGCLIVSN 273 Methanopyrus kandleri AV19
Q6LWZ4           243 IIFLDGWRSILGNIIggd----lvTKTSIALLV-GLLVVAVAAVIN 283 Methanococcus maripaludis S2
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap