2H2W


Conserved Protein Domain Family
HTS

?
pfam04204: HTS 
Click on image for an interactive view with Cn3D
Homoserine O-succinyltransferase
Statistics
?
PSSM-Id: 398054
Aligned: 55 rows
Threshold Bit Score: 324.498
Threshold Setting Gi: 81740477
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H2W_A        14 PINVPSGLPAVKVLAKEGIFVMTEKRAIHQDIRPLEILILNLMPDK--IKTEIQLLRLLGNT--PLQVNVTLLYTETHKP 89  Thermotoga mari...
Q89GR5         2 TVLIDVDSDEHHLLSRAPGNGARAMASPGNRAECLDIGLINNMSDAalMSTERQLFDLLAAAagRLCVRLHFYTMEATPR 81  Bradyrhizobium ...
Q8G7A5         2 PIKIPSGLPARDILDSERIFALEKPEAERQRVRPLKLVILNLMPKK--IETETQLLRLISKS--PLQVEIDFMKTSTHEA 77  Bifidobacterium...
Q9PLV2         2 PLIIPENIPAYELL-KEHAFIMGLRRAKHQDIRPQEILIVNLMPKK--IETENQILSLLANS--PLQVNITLLATTSYVG 76  Campylobacter j...
Q7VIG8         2 PLIIPEDIPAYKFL-NQNAFVMGSQRAKHQDIRALEVLIVNLMPTK--IETENQILSLLANS--PLQINITLLSTSSYIG 76  Helicobacter he...
Q7VCD9         2 ALILPRGYHKISAVERNHISWIEPELAERQDIRPLRIGILNIMPLG--KQYEFNLLHPLGLS--PLQIEPIWIRLNSHSY 77  Prochlorococcus...
WP_011935213   2 ALILPKNYHKVAAIERNGISWIEPELAERQDIRPLRIGIINIMPLG--MQYEFNLLHPLGLS--PLQIEPVWIRLQSHDY 77  Synechococcus s...
Q89XR3         2 TILIDRD----HGMSSPALVPAEGDLARDHAGAELTIGLINNMPDPalKATERQFMKLLQAAagPRRIRFHCFSLPSVKR 77  Bradyrhizobium ...
A1BAL9         2 PITLPNDLPAYDILSNEGVMVMSPGRAATQDIRPLRIGLLNLMPKK--IQTENQFARLIGAT--PLQIDFQLIRMSDHES 77  Paracoccus deni...
Q1GGV4         2 PIKIPADLPAYSVLSDEGVMVMSPDQAARQDIRPIKIGLLNLMPKK--IQTENQFARLIGAT--PLQIEFSLIRMTEHQT 77  Ruegeria sp. TM...
2H2W_A        90 KHTPIEHILKFYTTFSAV--KDRKFDGFIITGAPVELLPFEEVDYWEELTEIMEWSRHNVYSTMFICWAAQAGLYYFYGI 167 Thermotoga mari...
Q89GR5        82 SEWGRDYVRRYYRGIDDL--LNRRLDGVIVTGAEPRAASLTDEPYWTTFAEIADWARENTVSSVFSCLAVHGAVLHLDGV 159 Bradyrhizobium ...
Q8G7A5        78 THVSADHLVKFYENLDAF--KDNYYDGFVVTGAPVEHMPFEDVDYWDEFKTILDWASTHVFSTIYLCWGAMGALYYRYGI 155 Bifidobacterium...
Q9PLV2        77 KNTPFTHLEKFYKGLEEV--KKHKFDGAIVTGAPVEQMDFEKVAYWEELLEIFDFLKQNVTSSMYICWGAMAALKYFYGV 154 Campylobacter j...
Q7VIG8        77 TNTPKSHLERFYVNFSEI--KGRNFDGAIVTGAPIEHLAFEQVAYWNEISTIMDYLKKHCTSTLYLCWGAMASLYHFHKI 154 Helicobacter he...
Q7VCD9        78 KTWDLDHLTNHYVSWEKAm-HPFPLDGLIITGAPVEHLPFEDVNYWPELVDLIKEARESCASTLGLCWAGFA-LAYLAGV 155 Prochlorococcus...
WP_011935213  78 KTWDHDHLDQQYRSWEQAn-ASASLDGLIITGAPVEHLAYEQVTYWQEMVELVGIARTQCASTLGLCWAGFA-LAYLAGV 155 Synechococcus s...
Q89XR3        78 SPEAKWHVESEYSDLADL--KRQRFDGLIVTGAEPVAPELDQEPYWRDLTDLVDWARTNTRSTIWSCLAAHAAVLHLDGI 155 Bradyrhizobium ...
A1BAL9        78 RNTAADHLQSFYRRFCEVeeTGEKFDGLIITGAPIEHLPFEEVTYWEELTRVFRWTQSHVHSTFGVCWGGMAMAWHFHRL 157 Paracoccus deni...
Q1GGV4        78 KNTAAAHMEEFYRPFQEV--RDEKFDGLIITGAPIEHLPFEDVTYWQELCEVFEWTQTNVHSTFGVCWGGMAMINYFHGV 155 Ruegeria sp. TM...
2H2W_A       168 PKYELPQKLSGVYKHRvA-KDSVLFRGHDDFFWAPHSRYTEVKKEDId---KVPELEILAESDEAGVYVVANKSE-RQIF 242 Thermotoga mari...
Q89GR5       160 TRHKLPTKCFGVFAQT-KtRHHPLMQDVPRTFRIPHARWNEVQEEDL----SDCGYSVLTWSAEAGVDCFVKQQK-NSLF 233 Bradyrhizobium ...
Q8G7A5       156 HKVDYPEKIFGVFPQYlQdEYCFLTNGFDEIDLQPHSRLAGVNENEVr---ANHDLQILTWGPQSGPGLIATRDF-SEVF 231 Bifidobacterium...
Q9PLV2       155 DKISLDKKIFGVYKHDkVsPDL-LLTNLDEKVLMPHSRHSSMDEEQIlalqKQGKLKILLRNKKIGSALL--RDE-KNIF 230 Campylobacter j...
Q7VIG8       155 PKISLPHKVFGIFAHHiIeNDL-LLSGLDENIRIPHSRHSGIDDQKV----RKSQLKILLESDICGICAL--KDD-KDFF 226 Helicobacter he...
Q7VCD9       156 NKKVFDKKLFGLFPMKsLiPAHPIMGTQDDTFYCPQSRHAGLPDEEMeaaqSQGRLRLLSYGEKVGYTIFETTDQ-RQLM 234 Prochlorococcus...
WP_011935213 156 DKTAFAQKLFGVFPMRsLkPGHALMGTQDDSFFCPQSRHAGLDDAAMeqaqRQGRLRLLAHGEQVGYSIFETPDQ-RQLM 234 Synechococcus s...
Q89XR3       156 ARRRLPAKCHGIFDCE-AvTGDPLTHALPAPLKVSHSRLNEIVESDL----EQAGYQVLTRSALAGVDVFVRQYAsRFVF 230 Bradyrhizobium ...
A1BAL9       158 EKHMLDHKAFGCFRHRnLvPASPYLRGFSDDVLVPVSRWTEVRQDEVd---AIPALQTLIASDQVGPCLLQDTGH-RALY 233 Paracoccus deni...
Q1GGV4       156 RKHMLDHKAFGCFRHQnLqPTSPYLRGFSDDFVIPVSRWTEMSQSEId---AAPGLTTLLGSADVGPCLVEDKAH-RALY 231 Ruegeria sp. TM...
2H2W_A       243 V--TGHPEYDRYTLRDEYYRDIGRNL-K-----VPIPANY---------------------------FPNDDPTKTPILT 287 Thermotoga mari...
Q89GR5       234 VhfQGHPEYETQSLLGEYRRDMGRFLrGenevcPTIPRGYlnkgaeeiliafrqkalsdrqpelfadFPADQLTRDLSNV 313 Bradyrhizobium ...
Q8G7A5       232 A--LGHWEYGKYTLAEEYERDMAKGMtN-----VPFPKNY---------------------------FPHDDPKLEPLFA 277 Bifidobacterium...
Q9PLV2       231 I--LGHLEYFKETLHQEYVRDNF----------IQKAKNY---------------------------Y---DKKGNIKYN 268 Campylobacter j...
Q7VIG8       227 I--LGHPEYAKNTLLLEYERDKQKGL-E-----ITQPLNY---------------------------F---NDKGEPVLS 268 Helicobacter he...
Q7VCD9       235 H--LGHPEYNVARLISEMERDKKRG--D-----VPPPENF--------------------------------SPNNPQTA 273 Prochlorococcus...
WP_011935213 235 H--LGHPEYSSGRLLAEMERDRARG--D-----VPPPQNF--------------------------------DAELPQTL 273 Synechococcus s...
Q89XR3       231 F--QGHPEYDALSLQREYLRDVGRYLvRerdnyPHLPVSYfdaateeklvrfekqarhqrhpalsneLPALNLRADIAAG 308 Bradyrhizobium ...
A1BAL9       234 V--FNHFEYDSTTLKDEYDRDVVSGK-P-----INVPVNY---------------------------YPDDDPSRAPTNR 278 Paracoccus deni...
Q1GGV4       232 I--FNHFEYDSDTLKQEYDRDVASGT-E-----INVPINY---------------------------YPDDDPSQRPLNR 276 Ruegeria sp. TM...
2H2W_A       288 WWSHAHLFFSNWLNYCIYQKTPY 310 Thermotoga maritima
Q89GR5       314 WHLPAQHIYRNWLQYMVSQPAGR 336 Bradyrhizobium japonicum
Q8G7A5       278 WRAHANLLWRNWLN-WVYQTTPY 299 Bifidobacterium longum
Q9PLV2       269 WRSNANTIFANWLNYDVYQSTPF 291 Campylobacter jejuni subsp. jejuni NCTC 11168 = ATCC 700819
Q7VIG8       269 WKSSASVLFSNWLNFSVYQDTPF 291 Helicobacter hepaticus
Q7VCD9       274 WRSHRNLMFQQWL-WFCYQRVSL 295 Prochlorococcus marinus
WP_011935213 274 WRSHRNLFFQQWL-WFCYQRISL 295 Synechococcus sp. RCC307
Q89XR3       309 --SAAAALFRNWLQYLGADADAS 329 Bradyrhizobium japonicum
A1BAL9       279 WRSHAHLLYGNWIN-EIYQTTHF 300 Paracoccus denitrificans PD1222
Q1GGV4       277 WRSHAHLLYGNWVS-EIYQTTPY 298 Ruegeria sp. TM1040
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap