Conserved Protein Domain Family
TPD52

?
pfam04201: TPD52 
tumor protein D52 family
The hD52 gene was originally identified through its elevated expression level in human breast carcinoma. Cloning of D52 homologs from other species has indicated that D52 may play roles in calcium-mediated signal transduction and cell proliferation. Two human homologs of hD52, hD53 and hD54, have also been identified, demonstrating the existence of a novel gene/protein family. These proteins have an amino terminal coiled-coil that allows members to form homo- and heterodimers with each other.
Statistics
?
PSSM-Id: 398052
Aligned: 19 rows
Threshold Bit Score: 179.893
Threshold Setting Gi: 27808682
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q3SYU8        20 DSMTDVPVDTAVAAQAPAveGLTETEAEELRAELAKVEEEIVTLRQVLAAKERHCGELKRKLGLSTLEGLKQNLSRSWHD 99  cattle
XP_003269526  52 DPVPEEGEDVAATISATE--TLSEEEQEELRRELAKVEEEIQTLSQVLAAKEKHLAEIKRKLGINSLQELKQNIAKGWQD 129 northern white-...
NP_989546     12 QSLHEADEDMVTDVDFTS--MISEEEKEELKAELAKLEDEISTLRQVLAAKEKHLIEIKQKLGMSLMNELKQNFSKSWHD 89  chicken
XP_015215213  12 EPLQEVDEDVVAEVDLNN--SVSEEEREEIQTELAKLEEEIAALKQVLAAKEKHHAELKLKLGMNPLNDLKQNVSKSWHE 89  spotted gar
XP_022540622  33 EPLQEVDEEMVSEVDLNN--TITEEEKEEMHNELTKLEEEITTLRQVLSSKEKRHSELKQRLGITPLSELRHNLSRGWND 110 Mexican tetra
XP_011490162  91 EPLREADEDAASEVHLNNs-TMTEEEREEIQQELVKLEEEIGTLKQVLSSKEKQQAELRQKLGITPLSELKNNFSRSWHD 169 Japanese medaka
XP_007484570  12 DPLHEPVEETISHIDLNS---ISEEEREELKTELVKLEDEISTLPQVLTAKEKHLVEIKQKLGMNLMNEIKQNFSKGWHE 88  gray short-tail...
XP_002936056  13 QPLQETDEELATDIDYSE--TISEEEKEELKSELFKLENEIVTLRQVLAAKEKHLVEIKQKLGVSMMNELKQNFSRSWHD 90  tropical clawed...
XP_015212510  52 EPIPEVGEDAVSTVSLSAp-ALTEEEQEELRAELAKVEDEIQTLSQVLAAKEKHVAEIKRKLGISPLNELKQNITKGWQD 130 spotted gar
XP_028913741  15 EPLQGANEGRSSEIVFLS--MISEEEREELKTELVKLEEEVSTLRQVLSAKEKHRLEIKQKLGMTLMDELRQNLSKGWHD 92  platypus
Q3SYU8       100 MQVSNAYkktqetlsqagQKTSAALSTMGSAISRKLGD------------------MRNSATFKSFEDRVG----TikSK 157 cattle
XP_003269526 130 MTATSAYkktsetlsqagQKASAAFSSVGSVITKKLED------------------VKNSPTFKSFEEKVE----NlkSK 187 northern white-...
NP_989546     90 MQTTSAYkkthetlshagQKATAAISNVGTAISKKFGDmrshsisysirhsismpaMRNSPTFKSFEEKVEttvtSlkTK 169 chicken
XP_015215213  90 VQTSTAYkktqetlstagQKATAALSNVGTAISRKFGD------------------MRNSPSFRSFEEKVEstvsTlkTK 151 spotted gar
XP_022540622 111 MQTSTAYkktsetlstagQKTTAAFSNLGSAISRKFGDmstqpsysi-rhsvsmptMRNSPSFKSFEEKVEstvtNikSK 189 Mexican tetra
XP_011490162 170 VQTSVAFkktsetfstagQKTSAAFSTFGSAITRKLGD------------------MRNSPSFKSFEEKVEstvsTikTK 231 Japanese medaka
XP_007484570  89 MQTTTAYkkthetlshagQKATAAFTNVGTAISKKFGD------------------MRNSPTFRSFEERVEttvtNlkTK 150 gray short-tail...
XP_002936056  91 VQTHSAYkktqetlsqagLKATAAITNVGSAIGKKLGDmrshsisysirhsismpaMRNSPTFKSFEERVEntvtTlrAK 170 tropical clawed...
XP_015212510 131 MTASTAYkktsetlsqagQKATAAFSSVGSAITKKLED------------------VRNSPTFKSFEEKVE----TlkTK 188 spotted gar
XP_028913741  93 VQTTSAYkkthetlsqagLKATAALNNMGMAISRKFGD------------------MRNSPTFKSFEERVEttvtSlkMK 154 platypus
Q3SYU8       158 VVGGREn----gGDNLPSPTGSGD 177 cattle
XP_003269526 188 VGGTKPagg-dfGEVLNSAANASA 210 northern white-cheeked gibbon
NP_989546    170 VGGTSHtgg-sfEEVLSSTAHASA 192 chicken
XP_015215213 152 VGGSSSsrg-sfEEVLSSTAHASA 174 spotted gar
XP_022540622 190 VGGTSSgg--sfEEVLSSAAQASA 211 Mexican tetra
XP_011490162 232 VGGSGPgg--nfEEVLSSAANASS 253 Japanese medaka
XP_007484570 151 VGGIPMgg--nfEEVLSSTAHASA 172 gray short-tailed opossum
XP_002936056 171 VGSANQtqg-sfEEVLSSTAHASA 193 tropical clawed frog
XP_015212510 189 VSSQPPtg--dfGEVLNSAASASA 210 spotted gar
XP_028913741 155 VGGAGGssggsfEEVLSSTAQASS 178 platypus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap