Conserved Protein Domain Family
Gcd10p

?
pfam04189: Gcd10p 
Gcd10p family
eIF-3 is a multi-subunit complex that stimulates translation initiation in vitro at several different steps. This family corresponds to the gamma subunit if eIF3. The Yeast protein Gcd10p has also been shown to be part of a complex with the methyltransferase Gcd14p that is involved in modifying tRNA.
Statistics
?
PSSM-Id: 398041
Aligned: 101 rows
Threshold Bit Score: 175.444
Threshold Setting Gi: 122016903
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
ERT03134              4 VIQPNAWIGLKLPSE-NVRFLRIAP-NTTISLGKYGSFPSNLIIHRPYHLTYELLDKRDDEPFSRLRVIPTDELYADVFA 81  Sporothr...
WGS:AADE:GA28174-PA   9 NIQLGDYIVIQ--RQkYTKLQKFGSlDTTSTLGKET-LELKSLLGQPYGSTFKMCVKETKTGKR-------GAQRQHTLE 78  Drosophi...
Q17EU7                4 TIKVGDYIVVK--RQkYTKLQKFTNlDTVVHLGKDQ-IELRHADNQPYHTTFQLVPKEG------------RNKRLFTLD 68  yellow f...
Q7PMA4                7 KIKVGDYLIIQ--RQkYTKLQKFNNlNTTVNLGKDQ-IELRLAENHPYCTTFHLVPKQE------------RGRRLYTLD 71  Anophele...
Q94416               12 LIKSGEYLIVQKIDGeQSRIVRFTP-KQKILIEKLK-FVADSAFGKPHGL-FEVSNNQclp-msVDRLIEELQLQEASVA 87  Caenorha...
XP_002902421         22 vIYEGDTVICQ-TSDgRMFFQTIAK-DESVRVGKKV-ASLKPVIGSFYGAIFEEQNKKLVKVT--------GGLFPDPVA 90  Phytopht...
XP_002969483          3 vVKAGSCVLLDINNGeHFVFSRLTP-AATVKLGKAK-YSLAPVIGCPFGSQFEPKSSSLERSSR-------AGDGKDNNA 73  Selagine...
jgi:OSTLU_15517      20 TMRVGDVVLIEINEGeRATFATLKE-GKSVDVGKRQKVPVEALLGAPFGSRYEIVHNTGAC----------VRLGAEGVD 88  Ostreoco...
Q018Q1               33 AMRENDVVLLEMNDGeRATFATLRA-GKVIDLGKRARAPAEAFLGAPFGSMYEARHNTGEVER--------IGATTEVIN 103 Ostreoco...
P0CS06               74 TIKEGDTVLLRLPSD-LVKSVVVQG-DNLVQLGKYGAFPASQLIGLHYDITYEIVSSSGSGAST-------PQPQSLDFS 144 Cryptoco...
ERT03134             82 DEAQAAASAmdaARGrtgdeadadgevengvdgggdgdfpglgddagtssveytlvdmesQAVIARS------NR-ATID 154 Sporothr...
WGS:AADE:GA28174-PA  79 LCSDTELRStreVLG---------------------------------------------ISSSGAD------NR-DICD 106 Drosophi...
Q17EU7               69 PVQTVSEIRnlkELL---------------------------------------------IKESGTD------NR-NIVD 96  yellow f...
Q7PMA4               72 ALSTPSEIRnlkELL---------------------------------------------IKESGND------NR-NIID 99  Anophele...
Q94416               88 TSSIDPEVTepsE--------------------------------------------------PSLDprvviaPSaLKLE 117 Caenorha...
XP_002902421         91 PETGDSFVP-------------------------------------------------------DGD------NR-HYAD 108 Phytopht...
XP_002969483         74 GEEEEEEEEna----------------------------------------------------aTKD------NR-NLID 94  Selagine...
jgi:OSTLU_15517      89 DDVAHGSAPve----------------------------------------------------dERS------NK-HVSN 109 Ostreoco...
Q018Q1              104 EETDDEEAFaapL-------------------------------------------------ADERS------NK-NVPN 127 Ostreoco...
P0CS06              145 TEETQSKKGnkkNKNkgkdtaavsknnpgwn--------------nilrplkrqlvvdavIDDIVET------NE-FIED 203 Cryptoco...
ERT03134            155 -ADA-RQTLTTDEIEALKREGTGaGRDLIAKLLLSHAALDQKTAFSLAKYKLLKTKKYIRRFTVLPLDVYTLGNWLLDdK 232 Sporothr...
WGS:AADE:GA28174-PA 107 -NGE-AQALKSSDIEQLREACNE-SSKIIEKLVENSKTFHTRTEYSQEKYLLKKEKKYFEFVQIRQPTIRLMVDIFYR-Q 182 Drosophi...
Q17EU7               97 -DRS-TQGLSAEEILKLREECES-SSEVIGKLVENSKSFAAKTEYSQEKYLKRKEKKYFEYVEIRRPSIRLIADVYWR-L 172 yellow f...
Q7PMA4              100 -DRQ-SQALSTEEILKLREECES-SSEVIGKLVENSKSFATKTEYSQEKYLKRKEKKYFEYITIRRPSIRLLTDIYWR-L 175 Anophele...
Q94416              118 pEQK-RQKLEMDAVLEMKKQGVS-GQEMVAKLVEGSASFQTRTVFSQSKYIKRKAKKHSDRVLILRPTIRLLAKAYYL-K 194 Caenorha...
XP_002902421        109 -TNS-AQTLKQTDIGELRESGAS-GQEIIQKLVENSSTWETKTEFSKQKYLKKKQQKYMPRVRFLRCTAESLCRTYRL-K 184 Phytopht...
XP_002969483         95 -DNT-AQTLSAEEIHSMKREGSS-GQEIVNALIANSASFESKTTFSQEKYKRKKQKKYAPRVIIRCPTAKSVCEAYFS-K 170 Selagine...
jgi:OSTLU_15517     110 kHEG-AQRLTDADIAALRRE-FT-GEEMVEIIAANSKTFDEKTAFAQEKYRARKMKKHMTRILVRFPSPRQVCEQYFY-S 185 Ostreoco...
Q018Q1              128 tEHG-AQTLTDSEIAALKRE-FT-GEEMVEIIAAYSKTFEEKTAFAQEKYKARKLKKHMTKILARFPSPRVVCEQYFY-E 203 Ostreoco...
P0CS06              204 lSETeKTTLSHDEIAELRAQGCT-PEEIIQAQIARHEKFGLKTDFSKEKWRRRKEKKFYQTVQPLAPSIPNVLYHYNL-R 281 Cryptoco...
ERT03134            233 DVGnKIMDLRDEMVALLGCWANVHYGGpsrylqappamppaetaetaasktgdgeetvmvdaqplvpdaqaeevataaaa 312 Sporothr...
WGS:AADE:GA28174-PA 183 DAE-KIMGIRVDTLSQIISYSGVCGFG----------------------------------------------------- 208 Drosophi...
Q17EU7              173 DAD-KVMGVRFDTLSQIISYSGVCGIG----------------------------------------------------- 198 yellow f...
Q7PMA4              176 DPE-KVLGVRFDTLSQIISYSGVCSVG----------------------------------------------------- 201 Anophele...
Q94416              195 DPD-RLAMLRADQLALILQMAGLHHGK----------------------------------------------------- 220 Caenorha...
XP_002902421        185 NPA-KICNLREDSLGQMLVYGNIFAGG----------------------------------------------------- 210 Phytopht...
XP_002969483        171 TPA-KIGFIRVDSLSMILSLANVGEMS----------------------------------------------------- 196 Selagine...
jgi:OSTLU_15517     186 NPY-KTSHMRFDALSMLLNAGNVGAHA----------------------------------------------------- 211 Ostreoco...
Q018Q1              204 NPS-KTSYMRFDSLSMLMNMANVGAHG----------------------------------------------------- 229 Ostreoco...
P0CS06              282 SPQ-SILHLRDDTLSQLLTMANVRPGG----------------------------------------------------- 307 Cryptoco...
ERT03134            313 dedeslleqppnllpddigsflgggRWLAVDD-TGGLLIAALAERMGIltnpeedddvedeqketkkettdantglgtsd 391 Sporothr...
WGS:AADE:GA28174-PA 209 -------------------------SYLLYESgTNGLLPAAMMNSIGA-------------------------------- 231 Drosophi...
Q17EU7              199 -------------------------RFLLYESgTNGLLPAAFINSIGA-------------------------------- 221 yellow f...
Q7PMA4              202 -------------------------NYLLYESgTNGLLPAAMLNSIGA-------------------------------- 224 Anophele...
Q94416              221 -------------------------NVVVFEQ-TLGLITSAVIERLGG-------------------------------- 242 Caenorha...
XP_002902421        211 -------------------------QVLVVDT-CMGLVAGAIAERQGG-------------------------------- 232 Phytopht...
XP_002969483        197 -------------------------NVLVSDM-VGGLLTAAVAERLSG-------------------------------- 218 Selagine...
jgi:OSTLU_15517     212 -------------------------QTLVLDT-CGGIVLGAVTHRMGG-------------------------------- 233 Ostreoco...
Q018Q1              230 -------------------------QTLVLET-CGGLVLGSIMHRMGG-------------------------------- 251 Ostreoco...
P0CS06              308 -------------------------RYLVVDD-TGGLITAAVLERMGS-------------------------------- 329 Cryptoco...
ERT03134            392 dkdgvpedadatagddagsaeedaaqhdllerrpkrpakrarddfhvsfSLANTITLLHSNNQ-ANLTYLKYFGYDyadp 470 Sporothr...
WGS:AADE:GA28174-PA 232 -------------------------------------------------GTEGTLVHMHPGNV-PQKQALLALKL----- 256 Drosophi...
Q17EU7              222 -------------------------------------------------ETEAKLVHMHPGNV-AQKQAIQAMNF----- 246 yellow f...
Q7PMA4              225 -------------------------------------------------ETGGKLVHLHPGNV-AQKQALFAMDY----- 249 Anophele...
Q94416              243 ---------------------------------------------------TGACIHIHRGAVaQSIPCVHSMNYD---- 267 Caenorha...
XP_002902421        233 ---------------------------------------------------SGRIICPYEGQQ-PAADILRRFNFDkr-- 258 Phytopht...
XP_002969483        219 ---------------------------------------------------FGTVCSVYYTPKaPSLDIVGLFNFD---- 243 Selagine...
jgi:OSTLU_15517     234 ---------------------------------------------------MGRICNGFIGQNpTAMDVLLQMNLE---- 258 Ostreoco...
Q018Q1              252 ---------------------------------------------------FGRICNGFVGTNpTGMEVVQNMNFD---- 276 Ostreoco...
P0CS06              330 ---------------------------------------------------EGSILLFNESDSpPAWGILQTMNFSdr-- 356 Cryptoco...
ERT03134            471 hhPPHPLNDH--LLCLSWL------------QLLE---PESDTVYAQAPP--IQPADVV 510 Sporothrix schenckii ATCC 58251
WGS:AADE:GA28174-PA 257 --PLEQQKRCvsVNLYSVLrefyqgnvapsiDHTE---VEAEETLPETPNeeQPEAVEp 310 Drosophila pseudoobscura pseu...
Q17EU7              247 --KPEQLNRCisVNLYSVLrhf-------------yqeGKAEVSEPSTPSeePKMEEEV 290 yellow fever mosquito
Q7PMA4              250 --PTEQQARCvsVNIYSVLrhfy------------qdrEGAKENEAQEPAvaEAKENET 294 Anopheles gambiae str. PEST
Q94416              268 ------------DNTLSTFlpvrikcvlagkHL-----PYDNNRKAVNGD--DDNLEEV 307 Caenorhabditis elegans
XP_002902421        259 -----------tLESIHYMpfk-------hvRLLEm--EEEDVTEPVKVArdGLTPEER 297 Phytophthora infestans T30-4
XP_002969483        244 --SATSSRIF--RVRLS--------------TLLE---SYNSGLQNGEPAplVVEQEKn 281 Selaginella moellendorffii
jgi:OSTLU_15517     259 --DAHFDCMR--HAALS--------------KLIErreGRMDEDSKMDEAngSKDGEKL 299 Ostreococcus lucimarinus CCE9901
Q018Q1              277 --PTHYDSVR--HASLS--------------GLIE---ARQKGAVEADTTraKSMETTE 314 Ostreococcus tauri
P0CS06              357 -----------eLEPIKWL------------NWLE---AEEEYQKPAPPVqaEPPTNPI 389 Cryptococcus neoformans var. ...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap