Conserved Protein Domain Family
ST7

?
pfam04184: ST7 
ST7 protein
The ST7 (for suppression of tumorigenicity 7) protein is thought to be a tumor suppressor gene. The molecular function of this protein is uncertain.
Statistics
?
PSSM-Id: 398038
Aligned: 7 rows
Threshold Bit Score: 844.857
Threshold Setting Gi: 74963701
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_003220504  41 PWAR--SLGLVAALGLLYCLRGPLRLRDNLAAVTV--FLSTLTPKFYVALTGTSSLISGLIFIFEWWYFRKYGTSFIEQV 116 green anole
A7S641        26 SWTYlwGFWFLLVIFLLYILRAPLRLKENMNLVIL--FLNTLTPKFYVALTGTSSFISGIILIFEWWYFRKYGTSFIEHI 103 starlet sea ane...
XP_001949568   9 IWRKlwWAWYLAIILVVCYTRECLRKKAIWDVVAV--FMDSLTPKFYIALTATSSFISALIMILEWIYFQKYGVSFIEQF 86  pea aphid
Q19337         4 SWTFlwLLWIALVAVLLFALRGPLKISESLESVTAtsYFNNLTPKFYVALTGTSSLVSGIILIFEWWYFKN--------- 74  Caenorhabditis ...
XP_012816546  25 CWAYgcLIFMVFSAVTLYYFRVPLRLYDNLAAVVV--FINTLTPKFYVALTGTSSVISGLILVFEWCYFKKYGTSFIEQV 102 tropical clawed...
XP_018668463  34 SWGYlwGIWLLLVAILVYFLRAPLKLSDNINAMSV--FISSLTPKFYVALTGTSSLLSGIILIFEWWYFRKYGTSFIEQV 111 vase tunicate
XP_030856337  19 IWVYlwVIWLLLVGVLVYILRSPLKVMENVNVVAM--FLNTLTPKFYVALTGTSSLISGLILIFEWWYFRKYGTSFIEQV 96  purple sea urchin
XP_003220504 117 SVSHLRPLIGGTENtISPqttfsatngenemNRQSLSECKVWRNPLNLFRGAEYSRYTWVTGKEPLTYYDMNLSAQDHQT 196 green anole
A7S641       104 SLAHLGPLIGGGDNtAPN-------------SSQNVAECKVWRNPMNLFRGAEYSRYLWVTGREPLTYYDMNLSAQDHQT 170 starlet sea ane...
XP_001949568  87 SLNYISPWIGGGND-----------------NNQQVPECKVWRNPLGLFRGAEYSRYLNYTKREPLTFYDMNLSAQDHQA 149 pea aphid
Q19337        75 -----NAGIDAGDEeGSDnde-------sieNTKTVPECKVWRNPMALFRAAEYNRFRKETNSEPLTYYDMNLSAQDHQS 142 Caenorhabditis ...
XP_012816546 103 SVNHLRPLMGGTEP-ASSsvgffpsigenepSRQPLSDCKVWRNPLNLFRGAEYNRYTWVTGREPLTYYDMNLSAQDHQT 181 tropical clawed...
XP_018668463 112 SVNHLGPLLGGEDNettst--------qandSKQ---KCKVWRNPLNLLRGSEYNRYNWVTGQEALTYYDMNLSAQDHQT 180 vase tunicate
XP_030856337  97 SLNHLSPWLGGAENggg-----------tstGQQSPPECKTWRNPLNLIRGAEYNRYNWVTGKDPLTYYDMNQSAQDHQT 165 purple sea urchin
XP_003220504 197 FFTCETD--SLRPSDSVMQKAWRERNPQARIKAAYQALEINND------CAMA----YVLLAEEEAITIVDAEKYFKQAL 264 green anole
A7S641       171 FFTCDADetSSNSADTIMLTAWRERDQEKRINAACRAYECDPT------SPTA----LILLAEEKAQTITEAEWYLKQAL 240 starlet sea ane...
XP_001949568 150 FFICDAD--NGKPDYEIMQAAWRERVPAARVKAAHLALEKNAD------CVTA----LIMLAEEEAPTMLKVEKILRKAL 217 pea aphid
Q19337       143 LFMCDED--QGRAEYEIMQVAWRERESEERIQTARAALAINPE------CASA----LVLLAEEESETVSQAENLLRRAL 210 Caenorhabditis ...
XP_012816546 182 FFTCDTD--SLRPSDSVMQKAWRERSPQARIKAAYQALNVYNDcatayvLLAEeeaaTISDAEIFFQQALKAGESAYRKS 259 tropical clawed...
XP_018668463 181 FFTCETD--NIRPADNVMQKAWRERNPQARIKAAHQALDLDQD------CATG----YILLAEEEAVTILEAERLFRRAL 248 vase tunicate
XP_030856337 166 LFTCDSD--PTRHQDEVMMKAWRERNPQNRIKAAHEALEKSGD------CATA----LVLLAEEEATTIVDAEKKFRQAL 233 purple sea urchin
XP_003220504 265 RAGETIYRk--SQHCSTQSPQHEAQLRRDTNVLVYVKRRLAMCARKLGRIKEAVKMMRDLMKEF-PLLSVLNIHENLLEA 341 green anole
A7S641       241 KTSDDLIR---NGASTNGDGKEDTIHRKNTNVCVYIRRRLAMCARKLGRTKEAIKMMRDLMKEF-PLMSVLNIHENLIEA 316 starlet sea ane...
XP_001949568 218 KLAEANYKr--TQKSHHLDSNIEMQHRRDLNVLIYIKRRIAMCCRKLRKLKEAVKMFRDLSKEMpPIMNILNVHENLIEV 295 pea aphid
Q19337       211 RAIESTLNsysNNQIASYAQNGDAVRKRDLTIQTYIKRRLAMCARKQGRLREAIKGFRDLSRDQ-SLSTLLSVQDNLIEA 289 Caenorhabditis ...
XP_012816546 260 QQ------------QQHLSSQHEAQHRRDTNVLIYTKRRLAMCARRLGRVREAVKIMRDLMKEF-PILSMVNIHENLLEA 326 tropical clawed...
XP_018668463 249 KAGEGLYRk--SQLLQHHSAMHEAEHRRDTNVLVYIKRRLSMCARKLGKTREAVKMMRDLMKEF-PMLNVLNIHENLLEA 325 vase tunicate
XP_030856337 234 KIAEANFKr--SQALQHHSPPHEKIHRRDLNVLVYIKRRIAMCMRKLGRTKEAVKMMRDLIKEF-PVVSMFQIHENLIEA 310 purple sea urchin
XP_003220504 342 LLELQAYADVQAVLAKYD--------DISLPKSAAICYTAALLKARAVSDRF--SPETASRRGLSTAEISAVEAIHRAVE 411 green anole
A7S641       317 LLEVQAYSEVQQVLAKYD--------DITLPKSATICYTAALLKARAVCDKF--SPEVAAKRGLSPAEMAAVEAIHRAVE 386 starlet sea ane...
XP_001949568 296 LLETQSYADVQSVLAKYD--------DINLPKSAVICYTSALLKIRVIADKY--NVGNTLKKGLTQAEEVALEAIHRAVE 365 pea aphid
Q19337       290 CLEVQAYADVQNLLVRYDgygapcsyELREPRSAAMSYTSALLKVRAVAENFrcAADSSIRRGLSSAEQTAIEALTRAME 369 Caenorhabditis ...
XP_012816546 327 LLELQAYADVHAVLSKYD--------DISLPKSATICYTAALLKARAVSERF--SPESASRRGLSTSEMNAVEAIHRAVE 396 tropical clawed...
XP_018668463 326 LLELQAYADAQALLFKYD--------DISLPKSATICYTAALLKARAVCDKF--SLEVATKRGLSSSEMTAVEAIHRAVE 395 vase tunicate
XP_030856337 311 LLEMQLYADVQALLAKYD--------DISLPKSATICYTAALLKARTVCDKF--SPEMASKRGLSTAEMNAVEAIHRAVE 380 purple sea urchin
XP_003220504 412 FNPHVPKYLLEMKSLILPPEHILKRGDSEAVAYAFFHLQHWKRIEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPSCTE 491 green anole
A7S641       387 FNPHVPKYLLEQKSLILPPEHILKRGDSEAVAYAFYHLPHWKQVEGAINLLHCTWEGTFRLVPYPLEKGHLFHPYPGCTE 466 starlet sea ane...
XP_001949568 366 FNPHVPKYLLEMKSYIFPPEHILKRGDSEAVAYAFFHLAHWKRIKGALAVLNVTWESAFNQIPYPLEKGYLFHPYPTCTE 445 pea aphid
Q19337       370 FNPHVPPYLLELRSMIMPPEHFLKRGDSEALAYAFFHIQHWKRIDGALQLLSIVWKDF---VPKVSKDKNAF---SSQLE 443 Caenorhabditis ...
XP_012816546 397 FNPHVPKYLLEMKSLVMPPEHILKRGDSEAVAYAFFHLQHWKRVEGALNLLQCTWEGTFRIIPYPLEKGHLFYPYPGCTE 476 tropical clawed...
XP_018668463 396 FNPHVPkyllemKSIILPPEHILKRGDSEAIAYAFYHLPQWKNVEGALNLLHCTWEGTFRMIPYPLEKGHLFYPYPNCTE 475 vase tunicate
XP_030856337 381 FNPHVPKYLLEMKSLILPPEHILKRGDSEAIAYSFLHIAHWKRVEGALQLLHCTWEGTFRMIPYPLEKGHLFYPYPSCTE 460 purple sea urchin
XP_003220504 492 TADRELLPT-FHDVSVYPQKELPFFIHFTAGLCSFTAMLALLTHQFPELMVIFTKA---FFGTLLSPLSFMMEKIERLMP 567 green anole
A7S641       467 NADRELLPV-HHQLSVYPKKELPFFILFTAGLCSFTALLALLTHQFPEPMAHLAKT---SLGWISAPFSLLIQKVEDFFP 542 starlet sea ane...
XP_001949568 446 LADRELLPT-YHKVSVFPKKDLPFFIHFTAGLSSFSALLALLIYLHPQFTGNLVYI---ICMWIIVPVNYCLDRLETMLP 521 pea aphid
Q19337       444 SADKELLPS-WHEQSVFPKTEGTLMMLLQTFICLAICILAVLAQQFPASSGEIFRT---AATIGMQFYENSVYTVSQWAP 519 Caenorhabditis ...
XP_012816546 477 NVDRELLPA-FHDVSVYPKKELPFFIHFTAGLSSFTAMLALLTHQFPELMGAFAKT---FLVTLLTPLSFVVEKIESIIP 552 tropical clawed...
XP_018668463 476 NADRELLPS-FHYVSVYPKKEWPFFIVFVGCLCSFTAMLAILTHQYPDIMILFAKAlseFLGMLVAPITFILEKLDSLMP 554 vase tunicate
XP_030856337 461 TVDRELLPSaFHEVSVYPKKELPFFILFTAGLCTFTASLALLTHQFPEPMGAIAKA---FLSSLSAPFSFMMERLEGIIP 537 purple sea urchin
XP_003220504 568 AGLWHQLSQ 576 green anole
A7S641       543 AHILHQLTR 551 starlet sea anemone
XP_001949568 522 NNVMDILSn 530 pea aphid
Q19337       520 GNIIPYLAS 528 Caenorhabditis elegans
XP_012816546 553 YNFWHQLTR 561 tropical clawed frog
XP_018668463 555 TSIWHVLTR 563 vase tunicate
XP_030856337 538 ASLLQQLTR 546 purple sea urchin
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap