3TO3


Conserved Protein Domain Family
IucA_IucC

?
pfam04183: IucA_IucC 
Click on image for an interactive view with Cn3D
IucA / IucC family
IucA and IucC catalyze discrete steps in biosynthesis of the siderophore aerobactin from N epsilon-acetyl-N epsilon-hydroxylysine and citrate. This family represents the N-terminal region. The C-terminal region appears to be related to iron transporter proteins.
Statistics
?
PSSM-Id: 398037
Aligned: 215 rows
Threshold Bit Score: 81.843
Threshold Setting Gi: 490060595
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3TO3_B       149 SYDELENH-LIDGHPYHPSYKARIGFQYRDNFRYGYEFXRPIKLIWIAAHKKNATvgyeneviydkilksevgerkleay 227 Bacillus anthra...
EPB89377     204 STIAWEQS-VVEGHATHPMHKARKSYPPMKVLLPGSYDLEHPKIRLVGLPKESAVlrgnyeelaqrlvdall------ea 276 Mucor circinell...
Q6CZN5       176 AAMLLDQWgSLEGHPYYPTWKSRPGLSDEDVQLLSPEFNARVPLRITALRRDMAYvecmphvddfhqwfalafpalwqdw 255 Pectobacterium ...
CAR40660     172 GATFLDQWgALEGHSYYPTWKSRPGLSDDDIVALSAEFGARVNLRIAAIQSDMVYcekmphiqdihqwfssafptvwnkw 251 Proteus mirabil...
WP_024910953 172 AATFLDQWgSLEGHPYYPTWKSRPGLSDWDIEHLSAEFGARVTLRLGALRADMTYcekmphiqdthqwfadafpdiwpvw 251 Chania multitud...
CAL44507     150 GLCISESL-PFKGHPIHVCTKTKVGLSSDELLKYSPEFFNKVPLHLLAISSDYVKqygdnsswitfl------------- 215 Flavobacterium ...
Q5HM50       156 DLSYSESL-VIEGHPTHPLTKTKLPLSTNELKLYAPEFEKVIPLNIMLIEKNHVVttainddqnfilnqvipey--rdrl 232 Staphylococcus ...
Q2FW72       156 DLTYSESL-VPEGHPTHPLTKTKLPLTMEEVRAYAPEFEKEIPLQIMMIEKDHVVctamdgndqfiideiipey--ynqi 232 Staphylococcus ...
Q2FW70       193 SYLRSEQA-VIEGHPLHPGAKLRKGLNALQTFLYSSEFNQPIKLKIVLIHSKLSRtmslskdydttvhqlfpd---likq 268 Staphylococcus ...
Q5HM48       194 SYLRSEQS-VIEGHPLHPGAKLRKGMNAEENFMYSSEFGNVIHLRAVFIHKSISRiqssnvdynvavkqmfpd---likt 269 Staphylococcus ...
3TO3_B       228 kerihsxgcdpkqyLFIPVHPWQWENFIISNYAEDIQDKGIIYLGESADDYCAQQSXRTLRNVTNPKr---pYVKVSLNI 304 Bacillus anthra...
EPB89377     277 ggnaeemrakyndyAFIAIHELQL-----PNVEQKFHDAYIFPEQ-YSIYVEALASLRSVARPDILPg---lSVKLCLGV 347 Mucor circinell...
Q6CZN5       256 kqrlnqqgldetqwLPLPIHSWHLENWVKSHYADEIAEGILLTDG-PDLITLPGMSFRTVLPVEPPSs---pFIKLPVAI 331 Pectobacterium ...
CAR40660     252 cewltsqyqnpqkwLPIPLHPWHLEHWIIAHFSKEIDEGILLPLG-PQLETAASMSFRTMLPTASRSp----FIKLPVAI 326 Proteus mirabil...
WP_024910953 252 cvwlrnqghspeewLPLPLHPWHLTHWVSEHFAKEIAAGIFLPDG-PGIETAPSMSFRTLLPTASAQm---pFIKLPVAI 327 Chania multitud...
CAL44507     216 --knelsiqinsdeIIIPVHPWHFEHVVKKEFKAELESGIIRIVEQ-KIHAMPTLSFRTLALCSKNEndlgmHVKVPVGI 292 Flavobacterium ...
Q5HM50       233 kcyleplrlnlndyRVMLIHPWQYDHTIGEQFEEWIAKKILLPTP-FTVESKATLSFRTMDLIHTPY-----HVKLPVNV 306 Staphylococcus ...
Q2FW72       233 rvflkslglksedyRAILVHPWQYDHTIGKYFEAWIAKKILIPTP-FTILSKATLSFRTMSLIDKPY-----HVKLPVDA 306 Staphylococcus ...
Q2FW70       269 leneftpkfnfndyHIMIVHPWQLDDVLHSDYQAEVDKELIIEAK-HTLDYYAGLSFRTLVPKYPAMs---pHIKLSTNV 344 Staphylococcus ...
Q5HM48       270 lekefgedfnlqnyHLMMVHPWQIKHILQSDYRDELNEKLILISN-HSVPYYAGLSFRTLVPKQPDLs---pHIKLSTNV 345 Staphylococcus ...
3TO3_B       305 LNTSTLRTLKPYSVASAPAISNWLSNVVSQDSYLRdesRVILLKEFSSVXYDtnkk------atyGSLGCIWRESVhhyl 378 Bacillus anthra...
EPB89377     348 KISSALRTVTPFTTYFGPGFSKLVPKLTYDRD------VLYVERELGTISYRheds------dvaKHCSSVIREAIeysp 415 Mucor circinell...
Q6CZN5       332 WMTSEMRSLQAKSIHMGPRISTIIEAILAQEGGFEq--RLAFFREEAAFHYKhavhq---ddalgKHLSVVFRDARvyer 406 Pectobacterium ...
CAR40660     327 WMTSEMRSLQAKSIHMGPRISTIIEDILRVDKDFDg--KLDFFREEVAWHFRhnvrm---ddaegKFLSVVFRDTQawer 401 Proteus mirabil...
WP_024910953 328 WMTSEMRSLQAKSIHMGPRISTVIEAILKAENGFDg--TLDCFLEEVAWHFLhrerk---ddsegKYLSVVFRSTLpwqr 402 Chania multitud...
CAL44507     293 QVTSVFRLLSKRDIYNGIVFSEKLKELSNQLIAVKnk-lGVIVPDLYGVHFKenvek---tnkqgPLLSFMLRENPvlms 368 Flavobacterium ...
Q5HM50       307 QATSAVRTVSSVTTVDGPKLSHALQGLLQEFP------ELQVAMEPYGAYAHtas-------dlsKQLALIIRQKPtiy- 372 Staphylococcus ...
Q2FW72       307 QATSAVRTVSTVTTVDGPKLSYALQNMLNQYP------GFKVAMEPFGEYANvdk-------draRQLACIIRQKPeid- 372 Staphylococcus ...
Q2FW70       345 HITGEIRTLSEQTTHNGPLMTRILNDILEKDVIFKs-yASTIIDEVAGIHFYneqdeadyqtersEQLGTLFRKNIyqmi 423 Staphylococcus ...
Q5HM48       346 HITGEIRTLSEQTTYNGPLVTQILREIMSKDEDFSh-yQSTYIDENAGIHFYnrndneaiqtdrsEQLGTLFRNNLyqfi 424 Staphylococcus ...
3TO3_B       379 -geqEDAVPFNGLYA 392 Bacillus anthracis str. Sterne
EPB89377     416 eykdDLFIPCGALVE 430 Mucor circinelloides f. circinelloides 1006PhL
Q6CZN5       407 -sdgALPVTVATLFT 420 Pectobacterium atrosepticum
CAR40660     402 -ndnLIAITVASLFT 415 Proteus mirabilis HI4320
WP_024910953 403 -tdnTLAITVATLFT 416 Chania multitudinisentens
CAL44507     369 -kpnEKIIVASSLIH 382 Flavobacterium psychrophilum JIP02/86
Q5HM50       373 --dyGCTVVTASLVN 385 Staphylococcus epidermidis RP62A
Q2FW72       373 --gkGATVVSASLVN 385 Staphylococcus aureus subsp. aureus NCTC 8325
Q2FW70       424 -pqeVTPLIPSSLVA 437 Staphylococcus aureus subsp. aureus NCTC 8325
Q5HM48       425 -sneTVPVIPSSLVA 438 Staphylococcus epidermidis RP62A
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap