4ATY,4JQP,3TSN,1YXO,1PS6


Conserved Protein Domain Family
PdxA

?
pfam04166: PdxA 
Click on image for an interactive view with Cn3D
Pyridoxal phosphate biosynthetic protein PdxA
In Escherichia coli the coenzyme pyridoxal 5'-phosphate is synthesized de novo by a pathway that is thought to involve the condensation of 4-(phosphohydroxy)-L-threonine and 1-deoxy-D-xylulose, catalyzed by the enzymes PdxA and PdxJ, to form either pyridoxine (vitamin B6) or pyridoxine 5'-phosphate.
Statistics
?
PSSM-Id: 398024
Aligned: 419 rows
Threshold Bit Score: 211.084
Threshold Setting Gi: 401871453
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4ATY_A                       48 SQPRIVLfGDAFVI---RryarqccpelmlrlvqlddlpsaepnaidmvdvaslpaeafvPGEVAAAAGTATLAYVSAAL 124 ...
CDB05815                     35 LCTPIIY-GSPKIAayhRkaldiqasfsiinkaeda------vdgrvnllacfdeevkveLGQSTKESGESALKALDKAM 107 ...
WGS:ACWZ:HMPREF0669_00511.1  35 LCTPIIY-GSPKLAayhSkvleiptnftiinsarea------tdgkvnlltcfdeeikvdFAHPSKDSGVAAIRALDAAI 107 ...
CDA96027                     35 MCVPIVY-GSPKVAayhKkvmntpaqftiihkaeda------megrlnllaaiedevkveLGTATPESGTAAMKSLDRAM 107 ...
CDD18236                     35 LCTPIIY-GSPKVAayyRkamnlpgqfsiiqkaeda------qdgrinllaaveeevkvdMGMPTPESGQAAVKALDRAM 107 ...
WP_022121007                 35 YCTPIIY-GSPKVAayyRkamnlpaqfsiiqkaeda------edgrinllpavdeevkvdMGMPTQESGTAAIKALDRAM 107 ...
CCZ15262                     35 LCIPIIY-GSPKIAayhRkaldiqanfsiinsaeea------cegrinmlacfdeevkvdMGTGTEDSRRAAEKATERAL 107 ...
WP_021988284                 34 ICTPILY-GSSKVAayhRktlnienfnlnsiqtprea-----npkrcnvinciddavkveLGQETAESDKAAMIALKKAL 107 ...
jgi:Odosp_0266               34 VCTPVLF-GSSKVAayhRkalnienfslnsiqnarda-----npkrcnivncvddaikvdLGQETPESDDAAVLALKAAL 107 ...
WP_009135405                 34 ICTPILY-GSSKVAayhRktlnienfnlnsiqtpqea-----nakrcnvincvddavkveLGKETQEGDEVAMIALKEAL 107 ...
4ATY_A                      125 RAARAGQVDAVIACPHSETAI--NASGV-RFAGYPGFVAHEMGMpaE-DVYLLLIGGGLRIVHATLHEGIASALARLDQR 200 ...
CDB05815                    108 TDFRSQLYDVLVACPVCLSNMaaNEVGY-TYSGLKEYVETCIGD--GaKGMKIMVNESLRIALATNGLAIKDVPANITEE 184 ...
WGS:ACWZ:HMPREF0669_00511.1 108 TDYREGLYDVLVSAPIDSANI--NVEGV-PFKGITHYLETCIGK--AnDALQIYSNEYLRIATLTNYIDIKDLPNYITKE 182 ...
CDA96027                    108 TDFRRGLFDVLVTTPVNKSNA--QMAGY-PFPGHTRFLETCVGE--GaQAFNIYVNSKMRVASLTGMVPVNQVVESITEE 182 ...
CDD18236                    108 TDYRNGLYDVLVTAPINNGNA--QIENY-PFQGHKKYIETCLGE--GkKGLSILVGGNLRIASVTEKTPLKEVAAGITTD 182 ...
WP_022121007                108 TDYRDELFDVLVTAPVNNQNA--QFEGF-QFKGHKEYIETCLGE--GaKGLSILCGGDLRIASVTGKTPLKDVPAAITQE 182 ...
CCZ15262                    108 EDFGKGLFDVLVAGPEGQE------DGC--YAQLRERLAAHFGH--EhTPFCVLTNDSMRLTTTTSGLPIKNVADGITAE 177 ...
WP_021988284                108 DDLDHQGIEIIVAAPQGIESF--KTEG---AYGCPDYLAKRYGV--K-NVMPVLVGTKMKIGFVTTHIPFKEIAANITPV 179 ...
jgi:Odosp_0266              108 TALDRNEIDVLVGAPQGCNSF--KP-----AASCPVFFSERYET--R-NVMPLLVGEKMKMGFVTNHLPFRDIAGNITVN 177 ...
WP_009135405                108 DALDQHAIDAVVAAPQSVKSF-----GLeNASGCPAFLAARYGV--K-DTMPLLVGAKMKIGFVTTHIPFKEITPHITAE 179 ...
4ATY_A                      201 HVERAARAAVQALQL-MGIAHPVVGLMGINPHAGEGGLFGRDDIDITEPVARKLRDdGMTVIGPQGADLLLT---NPDID 276 ...
CDB05815                    185 NILNKIRTLNTCLKRdFRLSNPRIGVLALNPKAD-----GVEEKEILLPAIKKAEEeGITAYGPYAAEDYFGknaCDAFD 259 ...
WGS:ACWZ:HMPREF0669_00511.1 183 NIIEKVTTLHKTLQKdYRISLPRIAVLAFNPDGN-----GEEEKNIIAPAITQLANeGINAFGPFAADRFWDndeFGMFD 257 ...
CDA96027                    183 NVMAKVRLFAETLRSdFRISNPRLAVLSLNPGIN--GEMGKEEREIILPAVEKLADeGIQVFGPYASDVFFGkgyYADFD 260 ...
CDD18236                    183 AIVEKVTLMQQTLKRdFMITNPRIAVLSLNPKSNEDTSCGIEEREVIIPAIDALAEkGVQAFGPYASDEFFGqgyFADFD 262 ...
WP_022121007                183 LIIEKVKQMHTSLKRdFMITNPRIAVLALNPSNNGEESCGPEEASIIIPAIDQLAEqKIQAFGPYPADEFFGnghFVEFD 262 ...
CCZ15262                    178 GLEKLTRDFFTSLKRdFRIYNPRIAVLALNPGTD-----GHEESEVIAPVTGKLYDeGVYAFGPYQANTFFGdgmYESFD 252 ...
WP_021988284                180 NILSKLKMLDNTLKKdFTIRKPRIAVLGLNPHSGENCLFGEEEKSIIIPAIEKAREnGIMALGPYSPENLFKgtdYEKFD 259 ...
jgi:Odosp_0266              178 NIYYKLKLLDACLKKdFTIRKPRIAVLGLNPHSGENCMYGEEEKNVIIPAIERARDnGIMALGPYAPDGLFSgveFEKFD 257 ...
WP_009135405                180 HIGKKLKMLDNCLKKdFTIRKPRIAVLGLNPHTGENCTFGEEEQNIILPALERAREnGIMALGPYAADNLFSgmeFEKFD 259 ...
4ATY_A                      277 VFVAMYHDQGHIPVKLRAGRHSAALSIGAGVLFSSVGHGSGFDIAGTLLADPAPLLGAIRLV 338 Paraburkholderia x...
CDB05815                    260 CTLAMYDDQANIPFTTTMQNNGIYYISSLPLVCTAPALTPDFTNAGHGVADENALRHAIYAA 321 Prevotella sp. CAG...
WGS:ACWZ:HMPREF0669_00511.1 258 AVLAMYHDQGIVPLKTLVQSDNVLTISGLPIVCTAPALFSPFNDAGEGIVNENCLRQAIYQA 319 Prevotella sp. ora...
CDA96027                    261 GALGMYYEQVRTPFLVLSDGEGVVYTAGLPLIRTAADLEVRYDMAGKGKADEFGFRQALFMA 322 Prevotella sp. CAG...
CDD18236                    263 GVMAMYHDQATIPFHSLYTEDGVIYTAGLPIIRTTADVTPSFSIAGTGHADETSFRHAIYLA 324 Prevotella sp. CAG...
WP_022121007                263 GIMAMYHDQATTPFHSLYTEDGVLFTAGLPLVHTAANTTPSYSITGCNEADAISFRHAIYLA 324 Prevotella copri
CCZ15262                    253 GVVAMYDDQGLIPFKTLATECGTCYVAGLPLVCTTTAHGARHDIAGTWQADVSPFRHAIYea 314 Prevotella sp. CAG...
WP_021988284                260 AILALYHDQGMVPFKTIEGNEGAVLIAGLPIVYTSTVSGTAYDIVGQNQADEIALNSALYlg 321 Culturomica massil...
jgi:Odosp_0266              258 VILAMYHDQGMIPFKTIEGNEGAVLLAGLPIVYTSTVHGMAYDITGQGIADESGMRNALYLA 319 Odoribacter splanc...
WP_009135405                260 AILALYHDQGMIPFKAIEGYEGAVLMTGLPVVYTSTVTGTAYDIVGKGEADESALRNALYLA 321 Odoribacter laneus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap