Conserved Protein Domain Family
Erv26

?
pfam04148: Erv26 
Transmembrane adaptor Erv26
Erv26 is an integral membrane protein that is packed into COPII vesicles and cycles between the ER and Golgi compartments. It directs pro-alkaline phosphatase into endoplasmic reticulum-derived COPII transport vesicles.
Statistics
?
PSSM-Id: 398015
Aligned: 73 rows
Threshold Bit Score: 198.545
Threshold Setting Gi: 242000460
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EMF10243               1 MWILPLLGYLGLVGGFLFLTLAIASGLYYLSELVEEHTVLSKKLLSRLIYTVIAIQFLLAAIDRFPLALSAFSIASHVIY 80   Sphaer...
XP_002434873           1 MLYFYLLSWLATVIQICFIILAVAAGLYYVAELVEEFTVMTGKIIRILILLTLAVYAGLFVFEDLPLTMIGCGVLSQVMH 80   black-...
ETN66050              55 MSFLGLLSYVSLLVQICFITVSIAAGLYYLAELVEEYTVVAKKVISYLVLGTATLYVVFIFTESFPWSMVLCGLGSQLLH 134  Anophe...
WGS:AANI:GJ20961-PA    1 MGFLFILSWISLAIQITFMTLSIVAGLYYLAELAEEYSTPARRFILFMISFTIFVYILLIFFEDFPWTMMSCGLAAQAFH 80   Drosop...
WGS:AFWA:PNEG_02655    1 mygLIFLSYFGFIAGFIFLTVCIACGLYYLSEFIEEYAEFSKRILKRLIYIVIFLHLILFIVDGFPFFSTLFSILLHIIY 80   Pneumo...
CCJ29403               5 I----FLSYLGLISGFLFLTVCIACGLYYLSEFIEEYTEFSKKLLRKMIYFVIFLHLVILILDKFPFFLIMFSILSHILY 80   Pneumo...
WGS:AACS:CC1G_00178    1 MALLQYLSYIAIVAAFAFVTLSLASGLLYVSELIEEHSRLAKIYGKRGTYTIIALHILLYFTDNLPFPQTLFSIICHIIY 80   Coprin...
CCA72541               1 MGLLYLLSYVAAVVAVVYVVLSLASGLLWIAELIEEHSRLAKTVGQRAIWVIVIIHLLLYF-DGLPPTHIAFSIFCHFVY 79   Serend...
Q5KP20                 1 MGLLHLLAVAGGIAAFLFVTLSLASGLLWLAELIEEHSKYAKTVGMRAIYAIIGLHIVLYFTDNLPITPILFSITCHFVY 80   Crypto...
Q1MTR8                 1 MIVLNALSYLGIVLGFIGMTVSIASALYYISEFVEEHSRLAKAFLCRLVYFIMAVMVFLVIFDGFPFWLSAFSIFSHYIY 80   Schizo...
EMF10243              81 SLNL-RRFPVVKLTDPIFLAS-----CVLVLVNHYLWFTHFSVT------SAPTHHSngrysyldPPSSKd------VPS 142  Sphaer...
XP_002434873          81 LLVL-RSFPFFNLYSVPFLLA-----SVLVVVNHILAFSFFSGK---------------------------------VYA 121  black-...
ETN66050             135 AFIL-TDFPYVRFLSPAFLGA-----VILLLVNHYLAFVYFQVQ---------------------------------YHA 175  Anophe...
WGS:AANI:GJ20961-PA   81 FCIM-TNFPFIQLLSVSFIGS-----LAMLVINHVLAFQYFTSV---------------------------------YVP 121  Drosop...
WGS:AFWA:PNEG_02655   81 FINL-RSFPCISVSSYQFITA-----IIFTVLNNLLWIWHFRSYfgllltYSSV-----------YVHKKdt----kDYT 139  Pneumo...
CCJ29403              81 LSNL-RSFPCISVYFLHIIYMnhlnlLVFTVLNHLFWIWHFRLYfsslltNSFT-----------YSKKKny----eGFT 144  Pneumo...
WGS:AACS:CC1G_00178   81 LQNFsASWPLIDLTSLSFIAS-----CICVVADHFLWFFYFAKVtnearrLRTYRAVvp-----------------ePPG 138  Coprin...
CCA72541              80 SRNItPRWPLISLTSPSFILS-----CIFVFVDHALFFNYFSQQkklarqRGRAPL---------YYRDApifangrEYS 145  Serend...
Q5KP20                81 LSNFsSSWPLISLTSPRFILS-----CILVVGDHFVWFFHFAAVaqe-akDYRVPKY--------RYGGQqakaagnNPS 146  Crypto...
Q1MTR8                81 KINF-DTFPFFSFKRMRFLLA-----CFLIVANHILWVRFFQVH------EFPIKPRgltydfv------gqrlltsRAS 142  Schizo...
EMF10243             143 FTEIASFFGLEVWFVPFALFVSLSAGENVLPSMGSEYATGAGSSFITPGQtptlnagagsgsymdvqaqhaggreefrgr 222  Sphaer...
XP_002434873         122 FSEVLAYFTICLWLVPFAFVVSLNANDSVLPTLAEKRPLLNDDN--DVVSny---------------------------- 171  black-...
ETN66050             176 FTEVMAYFTLCLWLVPFALFVSLSANDNVLPTSNERTHLLGGTD--DVVTny---------------------------- 225  Anophe...
WGS:AANI:GJ20961-PA  122 FTQVLAYFTVCLWMVPFALFVSLSANDNVLPTTISTNERRLGSSNPDVVSny---------------------------- 173  Drosop...
WGS:AFWA:PNEG_02655  140 LGQIASFFAICIWLIPFSLFVSLPAGDNILPISSNDYLSSGSSINYMR-------------------------------- 187  Pneumo...
CCJ29403             145 FNQIASFFAICVWLIPFSLFISLPAGDNVLPISLNDCSRPGSRIILTQ-------------------------------- 192  Pneumo...
WGS:AACS:CC1G_00178  139 FTEIASFFGLCVWLVPLFLFLSLSANDHAIPLTAVERPSSPQSFASQQ-------------------------------- 186  Coprin...
CCA72541             146 FGEIATFFAICVWAIPLFLFLGLSANENTLPIQQTTDMSGSSTAGR---------------------------------- 191  Serend...
Q5KP20               147 FGDVAAFFAVCVWFVPLYLFLSLSANDNALPSFDSSAPPSPSSSHVNLGSprl--------------------------- 199  Crypto...
Q1MTR8               143 FSQVASFMGVCVWSVPIGIFVSFTAADNTLPTITTPSSSSPDAYSS---------------------------------- 188  Schizo...
EMF10243             223 trhKRSNTQTGMAKAAVNGVRE 244  Sphaerulina musiva SO2202
XP_002434873         172 --fSQRNKRYGLL-FFFNKAKE 190  black-legged tick
ETN66050             226 ---fSSRKKAGLL-SLFTYAKE 243  Anopheles darlingi
WGS:AANI:GJ20961-PA  174 ---fSRNKKLGLL-SFFNYIKE 191  Drosophila virilis
WGS:AFWA:PNEG_02655  188 ---SDKYKRIGMIKSIFSKIKI 206  Pneumocystis murina B123
CCJ29403             193 ---NDKYKRIGLIKSIFSKVKI 211  Pneumocystis jirovecii
WGS:AACS:CC1G_00178  187 ---RQKASRVSLLRSMLSfmsf 205  Coprinopsis cinerea okayama7#130
CCA72541             192 ---GEARTRASLLRRILDPlls 210  Serendipita indica DSM 11827
Q5KP20               200 hahADRKHATSLIKSALLPlls 221  Cryptococcus neoformans
Q1MTR8               189 ---GSSRRTSNVLRQAYKKLgi 207  Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap