5ZJN,1YXY


Conserved Protein Domain Family
NanE

?
pfam04131: NanE 
Click on image for an interactive view with Cn3D
Putative N-acetylmannosamine-6-phosphate epimerase
This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilisation pathway found mainly in pathogenic bacteria.
Statistics
?
PSSM-Id: 398001
Aligned: 7 rows
Threshold Bit Score: 310.897
Threshold Setting Gi: 29427988
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5ZJN_B  54 IVAMAIAVEQAGAKALRIEGVSNVAAVSAAVTIPIIGIVKRDLPDSPVRITPFVSDVDGLANAGATVIAFDATNRTRP-- 131 Vibrio cholerae
O51589  29 MSKMALAAKIGGAIGIRANGVNDISQIKLEVDLPIIGIIKKNYNNCDVFITPTMKEIDELCNEGVDIIALDATFRNRPdg 108 Borreliella burgdorfe...
P71340  35 VSAMAQASVMGGRSGLRIEGVDNLKATRPFVNVPIIGIVKRDLPDSPVRITPFLQDIEDLANAGADIIAVDGTSRPRP-- 112 Haemophilus influenza...
Q9L6B4  35 VAAMAQASVIGGAAGLRIEGIENLKATRNVVNVPIIGIVKRDLPDSPVRISPFLQDIEELAAAGADIIAFDGTDRVRP-- 112 Pasteurella multocida...
P0A761  35 VAAMALAAEQAGAVAIRIEGVANLQATRAVVSVPIIGIVKRDLEDSPVRITAYIEDVDALAQAGADIIAIDGTDRPRP-- 112 Escherichia coli K-12
Q9CGC2  34 MPLMAKAAAQAGAVGIRANSVRDIKEIQKIVDLPIIGIIKRDYPPQKPFITATMKEIDELVATSCEVIALDCTSRERYdg 113 Lactococcus lactis su...
1YXY_B  38 MPLMAKAAQEAGAVGIRANSVRDIKEIQAITDLPIIGIIKKDYPPQEPFITATMTEVDQLAALNIAVIAMDCTKRDRHdg 117 Streptococcus pyogenes
5ZJN_B 132 ESRERIAQAIKNTG--CFAMADCSTFEDGLWANSQGVEIVGSTLSGYVGDIEP---TVPDFQLVKAFSEAGFF--TMAEG 204 Vibrio cholerae
O51589 109 VLLDDFFENIKKKYpkQCLMADISSLDEAINADKLGFDFIGTTLYGYTKNTNGlniADNDFNFLRTLLNSNLKstLIVEG 188 Borreliella burgdorfe...
P71340 113 VDIESAVKKIHEMG--CLAMADCSNLEEGLYCKALGFDIVGSTMSGYTGGAVP---EEPDYQLVKDLKSAGCF--VMAEG 185 Haemophilus influenza...
Q9L6B4 113 TTREAIIKRIKELG--CLAMADCSNFEEGMYCHNLGVEIIGSTMSGYTGGEIP---AEPDYQLVKDLNAAGCR--VMAEG 185 Pasteurella multocida...
P0A761 113 VPVETLLARIHHHG--LLAMTDCSTPEDGLACQKLGAEIIGTTLSGYTTPETP---EEPDLALVKTLSDAGCR--VIAEG 185 Escherichia coli K-12
Q9CGC2 114 LTINEFIKSIKEKYpnQLLMADCSTFEECKNAYEAGVDFVGTTLSGYTDESPk--qDEPDFTLLEKLVEEKIP--VIAEG 189 Lactococcus lactis su...
1YXY_B 118 LDIASFIRQVKEKYpnQLLMADISTFDEGLVAHQAGIDFVGTTLSGYTPYSRq--eAGPDVALIEALCKAGIA--VIAEG 193 Streptococcus pyogenes
5ZJN_B 205 RYNTPELAAKAIESGAVAVTVGSALTRLEVVTQWFNNATQA 245 Vibrio cholerae
O51589 189 KIDTPLKAQKCFEMGVDLVVVGGAITRPAEITKKFVEKINQ 229 Borreliella burgdorferi B31
P71340 186 RYNTPELAKVAIEIGADCVTVGSALTRLEHIVSWFANSVKS 226 Haemophilus influenzae Rd KW20
Q9L6B4 186 RYNTPELAKTAIEIGAYSVTVGSALTRLEHIVSWFADAVKS 226 Pasteurella multocida subsp. multocida str. Pm70
P0A761 186 RYNTPAQAADAMRHGAWAVTVGSAITRLEHICQWYNTAMKK 226 Escherichia coli K-12
Q9CGC2 190 RIHSPEQAKRVYDIGVDAMVIGGAITRPFEIATRFIKAIGE 230 Lactococcus lactis subsp. lactis Il1403
1YXY_B 194 KIHSPEEAKKINDLGVAGIVVGGAITRPKEIAERFIEALKS 234 Streptococcus pyogenes
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap