Conserved Protein Domain Family
Iron_permease

?
pfam04120: Iron_permease 
Low affinity iron permease
Statistics
?
PSSM-Id: 397995
Aligned: 40 rows
Threshold Bit Score: 143.454
Threshold Setting Gi: 390623515
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Haur_0272         10 FTQVSKWTAHITGRPRTFGLAVGVIFLWMISGPLFGWSDTWQLVINTSTTIITFLMVFLIQNTQTRDSEAIQIKLDELIR 89  Herpeto...
jgi:Desti_2019        13 FRKFAHKCSDIAGSPWIFSAAVTIILLWGITGPFFGFSDTWQLIINTSTTIIIFLMVFLIQNTQNRESKAVQLKLDELIK 92  Desulfo...
WP_012870789           5 FDRLSSRIARMVGSYLAFLVACAVIIIWAASGTWFGFSDTWQLVINTGTTIVTFLMVFLIQATQNRDARATQLKLDELIR 84  Sphaero...
jgi:Anae109_2666       5 FARFALAISEVVGTPRAFLLALALVVVWGLSGPVFHFSDSWQLVINTGTTVVTFLMVFLIQATQNRETRALHLKLDELIR 84  Anaerom...
FDU:OP10G_3693         5 FSRIARWASNIAGSAPAFAACVLLIVVWAAFGPVFHYSDTWQLVINTSTTIITFLMVFLIQNAQNRDAKAIHLKLDELIR 84  Fimbrii...
WP_013478537          16 C--FAQNAAVATGSPWAFGLAVAVVVLWIVTGPLFKFSDTWQLVINTGTTIVTFLMVFLIQNTQNRDAKIMQLKLDELIR 93  Asticca...
jgi:AciPR4_2201       16 FGHFAAVTATYLGSRWAFAGAIGVIVLWAATGPVYHYSDTWQLIINTGTTIVTFLMVFLIQNTQNRDARAMNLKLDELIC 95  Terrigl...
Q1QG77                46 FGEIANRTSQAAGRALTFTIAVGVVIVWGISGPVFHYSDTWQLIINTGTTIVTFLMVFLIQNSQNRDSAAIQVKLDELIR 125 Nitroba...
goetting:OCA5_c06550  19 FAEIANWTSQAAGRASTFILAALVVFIWAMSGPIFHYSDTWQLVINTGTTIITFLMVFLIQSSQNRDSAAIQVKLDELIR 98  Oligotr...
jgi:M446_4617         27 FSDFAAAVARAAGKPVTFALSIAIILIWAVSGPFFHYSDTWQLIINTGTTIITFLMVFLIQNTQNRDGAAIQAKLDELIR 106 Methylo...
jgi:Haur_0272         90 ATQGAHNALLDLEELEEDELDQIRATYQRLSERAREAIRHGLVDT 134 Herpetosiphon aurantiacus DSM 785
jgi:Desti_2019        93 SMKEARNSFIDLEELSDEELESLQKQFKRLQQRDSSDRGASKEDA 137 Desulfomonile tiedjei DSM 6799
WP_012870789          85 AVTDARATFIDIEEGTERDLDTAEAEFRQSRSHDDASGRATARSR 129 Sphaerobacter thermophilus
jgi:Anae109_2666      85 AQRRARNIFADLEHATDEELAQLEAEFRRVHARAEARRQAKEASr 129 Anaeromyxobacter sp. Fw109-5
FDU:OP10G_3693        85 AQSGARNKMIDLEKLTDAQLQRLQQEFDKICNEEEPRTAAGRAQE 129 Fimbriimonas ginsengisoli Gsoil 348
WP_013478537          94 AASKANTAYIDMENMSEKELTALQTHYEALAKKAREQGDHKAAEA 138 Asticcacaulis excentricus
jgi:AciPR4_2201       96 SIDAAKNQMINIEHLSDSELDDLTNRYEQVRSQAMKRLGNKAVDE 140 Terriglobus saanensis SP1PR4
Q1QG77               126 VST-AQNSFVGIEHLTDEEIEEIRVKCERRSEAEKAGKAGVEATD 169 Nitrobacter hamburgensis X14
goetting:OCA5_c06550  99 VSA-AQNSFVGIEHLTDAELEEIRIKCETRAEVEKAGERTVEETA 142 Oligotropha carboxidovorans OM5
jgi:M446_4617        107 ASA-AQNVYIGIEHLTEEELDSLRARCEARAKSARAAEAADAAQG 150 Methylobacterium sp. 4-46
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap