Conserved Protein Domain Family
Mak10

?
pfam04112: Mak10 
Mak10 subunit, NatC N(alpha)-terminal acetyltransferase
NatC N(alpha)-terminal acetyltransferases contains Mak10p, Mak31p and Mak3p subunits. All three subunits are associated with each other to form the active complex.
Statistics
?
PSSM-Id: 397987
Aligned: 83 rows
Threshold Bit Score: 123.048
Threshold Setting Gi: 217404427
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CBQ70224        50 HGQMVAVPNFTLMDSMAAVKIMDARMDSGMElpAsELPESDrleetlalpatsqFDPFEPLT------------VPDVLW 117 Sporisorium r...
CCF57528        54 akDIVKTKECGFYEFTHALEVNNKKLDTSSI--PlKQEEIH-------------FDCNKPHGete------eerINFVTA 112 Kazachstania ...
CCK68814        47 aqSIIKVHSSDLFQGTHALEVNNPKLDSHLI--VlSEEELS-------------LSCDCAHGand------verLQYVTS 105 Kazachstania ...
XP_004180197    64 arAIIKSSEFDLFEGTHSLEVHNEKLDSSMI--NlTDKEVL-------------FDCNIPYGesd------edkLKIVSG 122 Tetrapisispor...
XP_001642366    52 pDVIIKSPNFDLFEGTRSLEVSNPKLDSSLI--QlSKEEID-------------FNCDLICGndnf-----ieqLQNVTA 111 Vanderwaltozy...
XP_003685726    27 EPTIIKASYFDLFEGTRSLEVENARLDSTLI--HlTEIEKN-------------FNCNAIIGdend----levqLDNIIS 87  Tetrapisispor...
Q6FV77          38 PETIVKDSKFNLFDGTHSLEVNNEKLDSTMI--QlTPEELQ-------------FDVGVAYGeeldastddpskLDIVIA 102 [Candida] gla...
XP_002555194     3 PESIIKDPSFDLFEGTHSLEIDNLKLDSSLL--ElSPEEKR-------------FDCSTPYGgse------eekLKFVTA 61  Lachancea the...
Q6CYA4          43 PETVVKEATFNLFEGTYALEVCNVKLDTSLI--ElCPEELE-------------FDCNVPYGdsnn-----gerLDYVTA 102 Kluyveromyces...
ybcl:Ecym_5471  33 ADEIVKLPDFDLFEGTHALEVNNVKLDSTLL--ElTPAELE-------------FDSKKAYGedr------daqIVFVTS 91  Eremothecium ...
CBQ70224       118 IMDRLLACEAAWHQG-SALSQTLYTCLYFHAIKSLSHKHPRFQRGsapsdassiaspetdasiqtATekdqqpLELVYKV 196 Sporisorium r...
CCF57528       113 IASRLLRSITTWLNDhQTFPATVLSCRYIEHFLIQLYSLPGTIDilk------------------------tgDEYYDTF 168 Kazachstania ...
CCK68814       106 IADRLLRSVITWLNEyQSLPATLLSCRYVEEFLIRNSQRDKALFkfn------------------------tdCIYYDQI 161 Kazachstania ...
XP_004180197   123 ICDRLVRSIISWLSDyQILPSTVLSCRYIEHILVESESHDKIRKle-------------------------sgHFLYDEV 177 Tetrapisispor...
XP_001642366   112 ISDRLLRSIICWLNEyQTLPTTVLSCRYVEHILKLSAINKKMTSlq-------------------------tgNDLYDRV 166 Vanderwaltozy...
XP_003685726    88 ISDRLLRNVISWLNNyQTLPTTILSCTYVEHILLASEKSHKIEPls-------------------------tgNELYDKT 142 Tetrapisispor...
Q6FV77         103 ISDRLLRSIISWLNDyQSLPTTVLSCIYVEHVLKYYMMDENADQN--------------------DItcletgDPFYDQV 162 [Candida] gla...
XP_002555194    62 VADRLCRSIMVWLAGfQTLPTTVLSCRYVEDAVRRYTDDPSTDLS---------------------ScllqtgNPLFDQV 120 Lachancea the...
Q6CYA4         103 VCDRLCRSLMNWLHDyQTLPTTVLSCRYVEFLMELYTSNPVSSLQ--------------------SFqglrtrDPLYDQV 162 Kluyveromyces...
ybcl:Ecym_5471  92 VVDRLCRSIMDWLNDyQSLPTTVLSCRYVDYLSERCKKVPKGKLE---------------------EaqlntgSELYDKV 150 Eremothecium ...
CBQ70224       197 LRAFILATVKTIDIAWTELtSKQHLHDGEDFASDKNGLSLLETTDTGYVIA 247 Sporisorium reilianum SRZ2
CCF57528       169 LNTCTASVCYFLSFVSNIQ-ETSILYEDEDLSFDPMALDSFHLLRNQAvia 218 Kazachstania africana CBS 2517
CCK68814       162 LTNIIAAICYFAAFVKSLL-LRAVIFEEEDLNFNSMGLQSFDIMPPQKLIl 211 Kazachstania naganishii CBS 8797
XP_004180197   178 LSSCVISVAYFAKFVLELL-KSGVIYEEEDLNFHTMGLNFFSYINNSNEIq 227 Tetrapisispora blattae CBS 6284
XP_001642366   167 LSSMVFGVCYFGKFVQQLL-VAGVILEEEDLNFNGMNLDFFSYIESsdevl 216 Vanderwaltozyma polyspora DSM 70294
XP_003685726   143 LSGLCIGICYFGKFVLHLM-KSGVLMEEEDLNFNFMGLDFLTFQESSkevl 192 Tetrapisispora phaffii CBS 4417
Q6FV77         163 LNSIIIGVCNFMGFMYKVL-TAGVIFEEEDLNFNHMGLNNFSMLPGinesl 212 [Candida] glabrata
XP_002555194   121 LTSCVVGSCFFVKFVSTLF-KAGVVFEEEDLNCNTMGLNMLSMVPITTIRE 170 Lachancea thermotolerans CBS 6340
Q6CYA4         163 LCSFVIGVCSFIKFTSKVL-KDGGVYEEEDLNCNVMSLDMLSGVDTKEVID 212 Kluyveromyces lactis
ybcl:Ecym_5471 151 LSTCVFATFSLIHFVDSLL-RAGVIYEEEDLNCNTMGLYMLDDVPVSEISD 200 Eremothecium cymbalariae DBVPG#7215
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap