5YFP


Conserved Protein Domain Family
Sec15

?
pfam04091: Sec15 
Click on image for an interactive view with Cn3D
Exocyst complex subunit Sec15-like
Statistics
?
PSSM-Id: 397972
Aligned: 109 rows
Threshold Bit Score: 260.925
Threshold Setting Gi: 505757028
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5YFP_F              521 YEKVLKICWMKEgehlSLPdptngepFAVTLPFSPLYPMTCTLAKKTYSKITAFLSIFYRHElHTLNNILVKTMDDIFND 600 Saccharo...
OWR45272            419 YDAVMDTFPYDGdeleTQP-------FPRRFPFTSLVPAVYVQVKEFIYAWLKYSAGLGLGG-GRRAAAARHSASLLLSR 490 Danaus p...
EDX12134            428 YECIIERFPFHSeqleNTP-------FPKKFPFSRMVPEVYHQAKEFMYACMKFAEELTLSP-NEVAAMVRKAANLLLTR 499 Drosophi...
Q17EP0              419 YDAVLERFPFHSeqleAQQ-------FPKKFPFSRMVPEVYHQAMEFMYACMKFSEELTLSP-NEIAAMVRKAANLLLTR 490 yellow f...
XP_001944089        421 YDNVVRTFPYQDdqleSST-------FPRKFPFSSMVPSVYDQVKQFIFACLKFSNDLNFSE-GEVDEMVQKSTKLLLSR 492 pea aphid
WGS:AATM:SJAG_03864 436 yceLIQPYWYDKkv----------dsFPVTMPFSKMCYECCQNADSFIRRFFMFLNDS-----ITLAVEVNERAPRLFRR 500 Schizosa...
XP_013025248        436 YDELIAPYWTLPpa-----------pFPRMVEFSKMCSLCCITLSKFARHFFMFSNDS-----ITLALDVQEKIPRFYRR 499 Schizosa...
O75006              436 YDHYIAPYWNFPse-----------pFPRTMSFSKMCPLCCTTLSKFVRHFFMFLNDS-----VILATEVNEKAPRFYRR 499 Schizosa...
XP_014255187        398 YDDVLSTFPFQDdeleTAP-------FPKRFPFSPLVPKVYQQVKEFIYACLKFSEDLNLSQ-GEVDDMIRKSTNLLLTR 469 bed bug
XP_016838806        437 YDKVLASFPYQDeelkKAR-------FPKKFPFSAMVPKVYHQVKEFIYACLKFSEDLNLTQ-TEIDEMICKSTNLLLTR 508 jewel wasp
5YFP_F              601 IVNKKIRSKLEST----SREEIAQILVNLDYFIIAAKEFSNFMTREnilq----------npdmEIRLSSIK--YLAESR 664 Saccharo...
OWR45272            491 SFTGCLSALFRRPl---PLTQLVQIIVDTQYLEDATSFLYEFISNitgse---------lvttqTAGS------MFQAAR 552 Danaus p...
EDX12134            500 SFSGCLSVVFRQPs--iTLTQLIQIIIDTQYLEKAGPFLDEFVCHmtnte---------rsvsqTPSA------MFHVAR 562 Drosophi...
Q17EP0              491 SFSGCLSAVFRSPs--lALMQVIQIIIDTQYLEKAGPFLDSFVCKmtgts---------qnvtqTPSA------MFQVAR 553 yellow f...
XP_001944089        493 TFSGCLSSAFHQPr--lGLLQVIQIIVDTGYLEKSSKSIQQFVSEatgst---------ggtvgD-----DAgiTLGVAR 556 pea aphid
WGS:AATM:SJAG_03864 501 FIKFGFVNQLTDRlprlGISQVAQVVQNFDAFEEPLLRMERILSSNksitpmaqmlpenaqpssHKATEMLE--EISHGR 578 Schizosa...
XP_013025248        500 FILHSLLDRLKHLypklNLSQMAQLVKNFYAFEEPLLQMEKTLVISkstshagne----itnvnikssELLE--GLANAR 573 Schizosa...
O75006              500 FILRSLVDRLKSLypklALSQMSQLVKNFYAFEDPLLQIEKSLVLNkpihqigaeasssnnvksT---ELLE--GLANAR 574 Schizosa...
XP_014255187        470 TFTGCLSSVFCKPs--lGLMQVIQIIIDTRYLEDATMYLEEFVSNitgspk---------egqlgSRGQGH---LFGVAR 535 bed bug
XP_016838806        509 TFSGCLSSLFRKPs--lALLQVVQIIINTEYLEKSTKYLEEFVSNitgtp---------hegqlSTGGLKSA--MFRVAR 575 jewel wasp
5YFP_F              665 KLAETKLIELIDSKISDIL-ETIEIDWQITEVRQ--DPDISIIDLAQFLEMMFASTLQNLPYSVQTLLIFREFDSLTRQF 741 Saccharo...
OWR45272            553 DDAEKQICEKLEKKVDEFL-DLENYDWL--LVEPsgQASSFVTDMLSYLSGVLTS-LEQLPQFARVAAVRAATNRIATRL 628 Danaus p...
EDX12134            563 QDAEKQVGLRICSKIDEFF-ELSAYDWL--LVEPpgIASAFITDMISYLKSTFDS-FAFKLPHIAQAACRRTFEHIAEKI 638 Drosophi...
Q17EP0              554 SEAEQQVSTKLCSKLDEFFeELEGYDWL--LPESygHASPFVTDMIAFLQSTFQS-FSYILPGVAQAACRKACEHVATRI 630 yellow f...
XP_001944089        557 NDAEHHMYDKMKLKLNEFL-DLEDYDWM--LVEPtgQASSFVTDLINFLRVVFNA-LRNLTEEVSVHVCQVAFEHISKSI 632 pea aphid
WGS:AATM:SJAG_03864 579 KQALHQIFICINHKIDDFV-DLAEYDWITTTPRT--TVSGYLQEMLAYLQTMYMEILGGIDNSDKSYIYLETLDHLSTAI 655 Schizosa...
XP_013025248        574 KSALHEIFVKINHKIDDFI-GLAEYDWSTTVPRT--APSGFLQEMVPYLQTIYLDSLAGLPNHDKSYVYLETLDHLCTAM 650 Schizosa...
O75006              575 KSALHEIFVKINLKIDDFL-GLAEYDWTTTQVRK--DVSGYLQEMVTYLQTMYLESLAGLPKHDKSYVYLETLDHLCTAM 651 Schizosa...
XP_014255187        536 DDAEKQICEKLKQKLDEFI-ELESYDWL--LSEPqgHASTFVSDLIAFLNSTFAS-FTNLPGEVAQVACKSACEHIAKSL 611 bed bug
XP_016838806        576 DDAEKQICEKLKQKLDEFL-ELENYDWN--LTEPqgHASGFIVDLIAFLQSTFTC-FTNLPEEVAQVACKSACSHIAKSI 651 jewel wasp
5YFP_F              742 MGLLLHDTPSTITHESIMNFEVDVNYLESIIPRIFpsTpGTidsngyqspmtpstptfpnangvdaptlfennikSLEAT 821 Saccharo...
OWR45272            629 RNLLLEPGVRQISSGALYQLDLDVIQCEQFAAAEPvpGlREg---------------------------------ELLEH 675 Danaus p...
EDX12134            639 YSIMYDEDVKQISTGALTQINLDLMQCEFFAASEPvpGlKEg---------------------------------ELSKY 685 Drosophi...
Q17EP0              631 YKLILSEEIKQISGGALDQINLDLMQFELFAASDPvpGlREg---------------------------------DLSKY 677 yellow f...
XP_001944089        633 LNLLLSDDIKQLSMGALNQLNLDVIQCELFAASEPvgKtDEp---------------------------------DFSQH 679 pea aphid
WGS:AATM:SJAG_03864 656 MKLITHPSVRRISSTAAAGFKLDIEFLESFAAKLPgqSi------------------------------------VNADS 699 Schizosa...
XP_013025248        651 IDLLSNPAIRKISTAAAEGFKVDVEYLESFASQVPdqSi------------------------------------VNADS 694 Schizosa...
O75006              652 VDLLSDPSIRKVTTAAAEGFKLDVEYLESFAAQVPdqSi------------------------------------VNADS 695 Schizosa...
XP_014255187        612 MKMIMKDNVKQISMGALQQLNLDTIQCEQFAASEPvpGlDEe---------------------------------ALLHY 658 bed bug
XP_016838806        652 LGILVSEDLKQISMGALQQVNLDTIQCEQFAASEPvvGlPEg---------------------------------TLLQE 698 jewel wasp
5YFP_F              822 FMELKQCIEL-LkTQGKD-Y-NEPEIRLRKYSRIRQEDAALLLSKI 864 Saccharomyces cerevisiae S288C
OWR45272            676 FASLRQLLDLiT-GWDWSsYlHDVGIEGGKYALVTPRDAATLLEKL 720 Danaus plexippus plexippus
EDX12134            686 FLRNRQLLDLlI-LEEWStYfHDYGKQENRYHLVQPQSIIVILEKI 730 Drosophila simulans
Q17EP0              678 FAEIRQLLDLlI-SEDWSaYlHDFGKDENRYSLVHPSTIIVVLEKL 722 yellow fever mosquito
XP_001944089        680 FAPLRQLLDLlL-SWDWStYfHDYGQETSKYSHVKPTTAIIVLEKL 724 pea aphid
WGS:AATM:SJAG_03864 700 FIELRQSAKLlQ-AENVEeY-MDADKFVRDFSRLDTSTAIKLLEKL 743 Schizosaccharomyces japonicus yFS275
XP_013025248        695 FIELRQCANLlL-GDNIEdY-LDTDKFTRDFNRLHPSTSVKLLERL 738 Schizosaccharomyces cryophilus OY26
O75006              696 FIELRQCANLlL-GDNMEeY-LDTDKFMRDFNRLQPAVAIKFLERh 739 Schizosaccharomyces pombe 972h-
XP_014255187        659 FTDLRQLLDLfM-SWDWPtYfHDYGQENSKYQQVNPNTAIILLEKM 703 bed bug
XP_016838806        699 FAQLRQLLDLfM-SWDWPtYfHDYISESSKYNLVTPQMAVILLEKL 743 jewel wasp
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap