Conserved Protein Domain Family
Peroxin-13_N

?
pfam04088: Peroxin-13_N 
Peroxin 13, N-terminal region
Both termini of the Peroxin-13 are oriented to the cytosol. Peroxin-13 is required for peroxisomal association of peroxin-14.
Statistics
?
PSSM-Id: 397970
Aligned: 85 rows
Threshold Bit Score: 117.658
Threshold Setting Gi: 74896770
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
EPB85092      152 GLTQRMETSTRATFDVIESIVSAFGGFAQMLDSTYMATHSSFMAMVGVAEQFGNLRHYLGGIFSIFALIRWMKRLLYRLT 231 Mucor circinel...
10_pfamImport   1 RFLQVAEEATNNTFQSIESFVRAFSSITLMLESTYQALHMSFRSVLSVADNMSKLRSVALNIFSSLSILKFLYWMYRRIL 80 
XP_004922625  127 RFIQLAEENSRPAFDSIQSLVSAVGSIAMMLENTFFALTSSFRAILGVAENFGRLRTVFAQFWSTFAVIRTLNWIFKKLL 206 domestic silkworm
XP_001986084  110 RFIQMAEASSRPAFQSIESLVSAIGNIASMLDSTFFALTSSFRAILGVAANFGRLRSVFGQFWASFAIFRGLRWIYRKIL 189 Drosophila gri...
Q17CV7        114 RFIQLAEESSRPAFQNIESLVGAIGNIAAMLDSTFFALTSSFRAVLGVAANFAHLRGVFAQFWTSFALFRWIIWAYRKIL 193 yellow fever m...
Q7Q0Y2         85 RFIQLAEESSRPAFQILESLVGAVGNVATMLDSTFFAVTSSFRAVLSVAANLAHLKGTFAQFWSSLAVVRAAVWLYKKML 164 Anopheles gamb...
XP_008208273  113 RFVQYAEESTRPAFQSIEAMVHTFSSVTMMLESTFFAMTSSFRAILGVADNMGKLRSMLKQLLSSFALVRFMKWLYLRVK 192 jewel wasp
EFN89103       89 SFQQYVEETTRPIVNVVESVLNTLGSITAVVESSHYTLLTSFRTYEVLADNIGRMRSTFGQLLSTLSLIRLLKWIYKKLL 168 Jerdon's jumpi...
XP_011257387  107 RFQQYAEESTRSTFRVVETVLHTFSSITMLLESTYFALTNSFRAILSVADNIGKLRSTLGQLLSTFALIRVMKWVYRKIL 186 Florida carpen...
XP_011058234  106 RFQQYAEESTRSTFRIVETVLHTFSSITMLLESTYFALTNSFRAILSVADNIGRLRSTIGQLLSTFALIRVMKWIYRRIL 185 Panamanian lea...
EPB85092      232 GR-TpppelygpteeqqqlnaeggeQTGALQITENGE-AVEATTTAAa-----gAESGEQQQQqqvarvSRKRPI-IIFL 303 Mucor circinel...
10_pfamImport  81 YMl----------------------GLVNQVPLRESVwKAAESQVLGttasnvgPEISQ----------PSTWPL-LGLF 127
XP_004922625  207 VMlG---------------------I---RSETEFKAwAEAVAATRGgdqaaaeRPP------------GSSWPI-LLFF 249 domestic silkworm
XP_001986084  190 YWl-----------------------RISHLDPSSKAfKKAFAKALNdnnmqesGAPHPPRKG------TSAWPV-LAFI 239 Drosophila gri...
Q17CV7        194 YWf-----------------------RITRTDPSTASfKEAFKAAEAdklapaqKK-------------GSSMPV-VLFL 236 yellow fever m...
Q7Q0Y2        165 YKl-----------------------RITKTDPTLEAfKEAFNVSTGsdvngnnNGRKH----------SSSLLA-ALFM 210 Anopheles gamb...
XP_008208273  193 YTlG---------------------I-RSQDASSEMLwRETISEVMNgsse---------------qsgTTSWPI-FLFL 234 jewel wasp
EFN89103      169 VLl----------------------GKESQDTLNEMLwQNSMSQMKSqeeg---------------hspIFTWHTsFLFV 211 Jerdon's jumpi...
XP_011257387  187 FMlG---------------------LRNTQNVITEDLwQQSISQTTNgertvtaNGH------------ISSWIN-ILFL 232 Florida carpen...
XP_011058234  186 FTl----------------------GLQTQNAVVEDLwQQSVSQLTNgeqipitTATNER---------ISPWMN-ILLL 233 Panamanian lea...
EPB85092      304 ALVTGLPYLMYKLI 317 Mucor circinelloides f. circinelloides 1006PhL
10_pfamImport 128 GLMLGAPYILYRVL 141
XP_004922625  250 GVIAAAPYIVLKML 263 domestic silkworm
XP_001986084  240 SFIFTAPYLIMKLL 253 Drosophila grimshawi
Q17CV7        237 GFIMSAPYLLMKLF 250 yellow fever mosquito
Q7Q0Y2        211 GFMLSVPYMLIKLF 224 Anopheles gambiae str. PEST
XP_008208273  235 SILFATPYLIHRLI 248 jewel wasp
EFN89103      212 TIFAVIPYLILKIM 225 Jerdon's jumping ant
XP_011257387  233 GIFVAIPYLIHKIS 246 Florida carpenter ant
XP_011058234  234 GVFVAIPYLIHKIT 247 Panamanian leafcutter ant
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap