Conserved Protein Domain Family
ORMDL

?
pfam04061: ORMDL 
ORMDL family
Evidence form suggests that ORMDLs are involved in protein folding in the ER. Orm proteins have been identified as negative regulators of sphingolipid synthesis that form a conserved complex with serine palmitoyltransferase, the first and rate-limiting enzyme in sphingolipid production. This novel and conserved protein complex, has been termed the SPOTS complex (serine palmitoyltransferase, Orm1/2, Tsc3, and Sac1).
Statistics
?
PSSM-Id: 397947
Aligned: 75 rows
Threshold Bit Score: 128.447
Threshold Setting Gi: 220976784
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q6FTN1        68 NMNATWMDQPGAWIIHVVIILLLAGMYKVM-PGMST-KNAWSLTNTTYVIGSYVMFHWIKGTPFEF--NGGAYDNLTMWE 143 [Candida] glabrata
EGG13287      16 NRNESWMHSQSFWVVYIIGLLLFKLIISIVfPDYQY---GWLVVTVIHAIITWFAFHWQKGIPFDLs-DQGKYNRLTLWE 91  Cavenderia fasc...
EFA76698       7 NRNESWMHSQSFWVVYVLGLLLGKLTISILdPDFQY---GWLSITCLHALITFFGLHWQKGLPFFFpeHQGKYTRLTLWE 83  Heterostelium a...
VDD59644      57 NRNTEWFMYPGVWTTYILIIFFGWLAVLSV-SGCSP-GMAWTVVNLSHFLVTYHSFHWMKGTPF-Ge-DQGIYNALTWWE 132 wild cabbage
XP_004956119  19 NKNTEWFMYPGVWTTYILLLFFAWLLVLSV-SGCSP-GAAWTVVNLAHFAITYHFFHWKKGTPFAAd-DQGIYSRLTWWE 95  foxtail millet
EFJ31295      12 NKNTEWFQYPGIWTTYILIIFLSWLLVLSL-LGCSV-GTAWTIVNLVHFGVTYNFFHWKKGTPF-Ae-DQGLYSKLTWWE 87  Selaginella moe...
EFN59049      24 NKNTEWLNQKAAWCFYIILIVLCWLVLASW----TDpGMAWTYVHLGHGAITYFLLHWNKGSPIQD--DQGIYDNLTFWE 97  Chlorella varia...
EFJ51051      13 NKNTNWLNYPSVWTWYLAVIVLGWLGISAL---IDDaGLAWTYVHLIHGVATYYLLHWIKGSPnp--eDQGKYQALTFWE 87  Volvox carteri ...
CBJ29398      34 NKNTEWMQNSYTWVMYVLFIATIWGVVHMT-QIFSV-AKSTTMVNVVHGLITFYFFHWTKGSPDEF--TQGEWNGLTFWE 109 Ectocarpus sili...
KAE8949402     8 NKNVNWMDSRGFWTFYIMLLASLYMAMPIVfPTHGD---ALTAVNVIHGVVSFGIMHWIKGSPDDN--SMGDYRELTFYE 82  Phytophthora fr...
Q6FTN1       144 QIDGETLFTPTRKYLISVPIVLFLIVTHYSRgSHFfsKDFIWNCCVTFFGaILPKLPITHRLR 206 [Candida] glabrata
EGG13287      92 QIDKGQQYTPTRKFLTLVPIFLFMITLHSNG-ILG--APFYLNALASFIV-VLSKMPRMDRVR 150 Cavenderia fasciculata
EFA76698      84 QIDKGKQYTPTRKFFTLVPIVLFMITLHANG-ISG--LPFYLNAISSFVV-VLSKMPKMDRVR 142 Heterostelium album PN500
VDD59644     133 QMDNGQQLTSNRKFLTVVPIVLYLIASHTTD-YRH--PWLLLNTLALMVL-VVAKFPNMHKVR 191 wild cabbage
XP_004956119  96 QIDNGQQLTRNRKFLTVVPVVLYLIASHLTD-YKQ--PMFFLNTVAVFVL-VVAKLPNMHKVR 154 foxtail millet
EFJ31295      88 QMDHGRQLTRNRKFLMVVPVVLYLIASHTTD-YKN--PFLLLNTIAVLVL-VIAKLPHMHKVR 146 Selaginella moellendorffii
EFN59049      98 QIDDGVQGTATRKFFTVVPVVLFLLASHGAD-FRR--QPLGLNLLVVVVL-TIAKMSGMHKVR 156 Chlorella variabilis
EFJ51051      88 QVDNEAYGTRNRKIFTVVPVLLFVLATHGTD-FRK--QPLGLNLVVVVVL-LVAKLPALHKVR 146 Volvox carteri f. nagariensis
CBJ29398     110 QLDAGVPWTKTKKFMMIVPTVLCLIPLVVSD-YQP--RYLAVNLPVCCIL-LLAKSPLMHRVR 168 Ectocarpus siliculosus
KAE8949402    83 QIDQGHPWTNTKKFLMMIPTFLFLAASVATD-YDT--RHLLINFPIWATL-ILAKLPELDRVR 141 Phytophthora fragariae
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap