2H9A,4DJD


Conserved Protein Domain Family
FeS

?
pfam04060: FeS 
Putative Fe-S cluster
This family includes a domain with four conserved cysteines that probably form an Fe-S redox cluster.
Statistics
?
PSSM-Id: 397946
Aligned: 366 rows
Threshold Bit Score: 32.7878
Threshold Setting Gi: 505217256
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2H9A_A                  12 LPKKNCKECGQPTCLAFAMQIAAGKA-GLDACPY 44 
CCE25588                43 LPHANCGACGYPGCRPFAEALVKGEM-PPAKCSv 75  Methylomicrobium alcaliphilum 20Z
PRJNA210423:M911_09310  48 LPRANCGACGEAGCRSFAEALVQRRI-DPARCTP 80  Ectothiorhodospira haloalkaliphila
WP_012970385            44 LPKANCGACGEAGCRPFAEKLVKGEI-DPARCTv 76  Allochromatium vinosum
jgi:Slit_2487           47 LPHSNCGACGTAGCRNFAEQAVAGKI-EPARCSv 79  Sideroxydans lithotrophicus ES-1
BAL95437                47 LPKSNCGACGLAGCRNFAEKVVAGEV-VPARCTv 79  Rubrivivax gelatinosus IL144
jgi:Thivi_3179          44 LPMANCGACGTAGCRPFAEQLVKGET-EPGKCTv 76  Thiocystis violascens DSM 198
WP_011812885            44 LPRANCGACGVAGCRPFAEALINGET-QPSRCTv 76  Halorhodospira halophila
WP_002608587            41 LPNYNCGSCGYAGCSGLAEALVEGEVtVVGTCKp 74  Firmicutes
CBK87958                41 LPGYNCGGCGYPGCSGMAEALVSGEM-DHIACKP 73  Faecalitalea cylindroides T2-87
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap