4C0D,5AJD


Conserved Protein Domain Family
Not1

?
pfam04054: Not1 
CCR4-Not complex component, Not1
The Ccr4-Not complex is a global regulator of transcription that affects genes positively and negatively and is thought to regulate transcription factor TFIID.
Statistics
?
PSSM-Id: 397942
Aligned: 104 rows
Threshold Bit Score: 324.851
Threshold Setting Gi: 357526524
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4C0D_A        439 LLELNAPEh--VLETINFQTLTAFCNTFHILRPTKAPGFVYAWLELISHRIFIARMLAhTPQQKGWPMYAQLLIDLFKYL 516 
CCK72050     1695 FASITNKEtrkELRNFDVEFYNIFASYLHSLQPFAFPAFCFAWVSLISHRMFLPVMLS-LPKKAGWEKMLILIIDLFKFL 1773 Kazachstania ...
XP_003959459 1727 FSSIKDVKirkELYTFDIEFYNISATYLHSFQPFAFPGFSFAWVSLISHRMFLPQILR-LPDKSGWEKLTLLIIDLFKFL 1805 Kazachstania ...
P25655       1711 FVRISDSStrqELIEFDSVFYNTFSGYLHALQPFAFPGFSFAWVTLLSHRMLLPIMLR-LPNKIGWEKLMLLIIDLFKFL 1789 Saccharomyces...
CCE64445     1530 FVNINDAKirnEFIKFDSEFYEIFSTYLLALQPLAYPGFSFAFITLLSHRMFLPVMLR-LPENKGWENLTLLIIALFKFL 1608 Tetrapisispor...
XP_001643066 1359 FIKITDQQirkELIEFDNYFYNTFASYLHLIQPVAFPGFSFAFITLLSHRMFLPNMLR-LENKSGWKNLTILIIDLFRFL 1437 Vanderwaltozy...
CCE90120     1684 FIKVRNVVtrkELLDFDTEFYNIFSSYLQSAQPIAFPGFSFAWVTLISHRMFLPTMLR-LPNNAGWKNLMLLLIDLLKFL 1762 Torulaspora d...
XP_002497191 1700 FIKIKDQKtrkDFISFDTEFYKIFSSYLHSLQPIAFPGFSFAWVTLISHRMFLPTVLR-LPEKSGWKSLTLLLIDLLNFL 1778 Zygosaccharom...
CCH61566     1679 FIKVKNVDtrkELIEFEEEFYNIIAKFLHTIQPIAFPGFSFAWITLISHRMFLPIMLR-LENKSGWKSLTNLLIDLIKFM 1757 Tetrapisispor...
5AJD_A        176 rISDSSTRq--ELIEFDSVFYNTFSGYLHALQPFAFPGFSFAWVTLLSHRMLLPIMLR-LPNKIGWEKLMLLIIDLFKFL 252 
4C0D_A        517 APFLRNVELTKPMQILYKGTLRVLLVLLHDFPEFLCDYHYGFCDVIPPNCIQLRNLILSAFPRNMRLPDPFTPNLKVDML 596 
CCK72050     1774 DKYTKKDSVTDAVSVIYKGTLRIILGISNDFPEFLIENHYQLLNNLPCSYFQLKNVVLSAIPTKMCFPNPYNPTLQLSNL 1853 Kazachstania ...
XP_003959459 1806 DQYTKRGIVSDAISVVYKGTLRVILGISNDVPDFLIENHYELMNNLPATYFQLKNVILSSIPKKKIVPNPYDPNLNMADV 1885 Kazachstania ...
P25655       1790 DQYTSKHAVSDAVSVVYKGTLRVILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAIPKNMTVPNPYDVDLNMEDI 1869 Saccharomyces...
CCE64445     1609 DQYTEKEGISNAISVVYKGTLRVMLGISNDQPEYLIENHYELLSHLTASYVQLKNVILSAVPKKMFIPNPYNPQLEMKDI 1688 Tetrapisispor...
XP_001643066 1438 DQYTGKVGISNAISVVYKGALRVIIGISNDFPEYLIENHYEFMNALPSSYAQLKNVMLAAIPKKIMLPNPYDNGLDMDKI 1517 Vanderwaltozy...
CCE90120     1763 DKYTDKNEVSNAISVVYKGALRVFLGISNDMPEFLIENHLELMNNLPPTYFQLKNVILSAIPKKMMLPNPYDPTLSLEDI 1842 Torulaspora d...
XP_002497191 1779 NQYTHKNEIPNAVSVVYKGVLRVLLGISNDVPEYLIENHHELMNNLPSTYFQLKNVILSAIPKKMVLPNPYDPGLSMANI 1858 Zygosaccharom...
CCH61566     1758 EQYTDKNSIPDAISVVYKGALRVFLGISNDVPEYLIENHYELMNYLPPTYLQLKNVILGAIPKKMMIPNPYDPDLSMENI 1837 Tetrapisispor...
5AJD_A        253 DQYTSKHAVSDAVSVVYKGTLRIILGISNDMPSFLIENHYELMNNLPPTYFQLKNVILSAIPKNMTVPNPYDVDLNMEDI 332 
4C0D_A        597 SEINIAPRILTNFTGVMppQFKKDLDSYLKtRSPVTFLSDLRSNLQvs--------nePGNRYNLQLINALVLYVGTQAI 668 
CCK72050     1854 ESCQECPSVFYDPINDLs-TLKKPVDNYLR-IPSNSLLRTILGSVFrseydvrngvgfDFLSVDSKVVRAIVLHVGVEAG 1931 Kazachstania ...
XP_003959459 1886 ELCQQKPSIFYDPVKDLq-SLKKPVDNYLR-IPSNSLLKAILNGLYrteydvkigvgyDYLSIDNKLVRGVVLHVGIEAG 1963 Kazachstania ...
P25655       1870 PACKELPEVFFDPVIDLh-SLKKPVDNYLR-IPSNSLLRTILSAIYkdtydikkgvgyDFLSVDSKLIRAIVLHVGIEAG 1947 Saccharomyces...
CCE64445     1689 EDCQKNPSVFYDPVLDLh-VFKKPVDNYLR-IPSNSLFKTILNAVHkkeyvmkngvgyDYVAVDTKLVRAIVLHIGVEVG 1766 Tetrapisispor...
XP_001643066 1518 DSCKMQPTVFYDPVVDLh-SFKKPVDNYLR-IPSNSLMRTIINGVYrdeysfksgigyDYVSVDQKLVRAVVLHVGVEAG 1595 Vanderwaltozy...
CCE90120     1843 AACKEPPKVFYDLIAEFs-TLKKPVDNYLR-IPSNSLLKTIISNTYrneyelkngigyDYLSVDNNIVRAIVIHVGIEVG 1920 Torulaspora d...
XP_002497191 1859 DLCQEPPKVYYDPVNDLk-SLKKPVDNYLR-IPSNSLLRTIVSGLYrteyemrngvgyDYFTTDMKLVRAIVLHVGLEAG 1936 Zygosaccharom...
CCH61566     1838 ESCQQQPNIFYNPVNDLk-TLKKPVDNYLR-IPSNSLLRIIIASLFkdvyerkngigyEHLMVDSKLIRAIILHVGIEVG 1915 Tetrapisispor...
5AJD_A        333 PACKELPEVFFDPVIDLh-SLKKPVDNYLR-IPSNSLLRTILSAIYkdtydikkgvgyDFLSVDSKLIRAIVLHVGIEAG 410 
4C0D_A        669 AhihnkgstPSMStiTHSAHMDIFQNLAVD--LDTEGRYLFLNAIANQLRYPNSHTHYFSCTMLYLFAEAN-TEA----- 740 
CCK72050     1932 LenertssnAVFN--PESSYYTLLYNMIHD--GTAELKFQVIEVMVEQLRYPNIHTYWFNYVLLNMFTSKDf--Gdqiae 2005 Kazachstania ...
XP_003959459 1964 LenertsssAVFN--TKSSYYTLLYNLINE--GSTELRYQILQVMLEQLRYPNIHTYWFSYVLLNMFTSKEf--Gsnise 2037 Kazachstania ...
P25655       1948 IeykrtssnAVFN--TKSSYYTLLFNLIQN--GSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDEw--Ndqkle 2021 Saccharomyces...
CCE64445     1767 IdnektssnVIFN--TKSSYYTLLFDLINE--GSVELKSQLTEAIVEQLRYPNIHTYWFSYVLKQFFYSQDw--Gektse 1840 Tetrapisispor...
XP_001643066 1596 LesektssgAIFN--AKSSYYTLLFNLLNE--GSSEVRFKVIEAMMEQLRYPNIHTHWFTFVLKNMFTSEEw--Geqkse 1669 Vanderwaltozy...
CCE90120     1921 SeyqrmsssAVFN--TKSAYYTLLFNLIHD--GTVELQYQVIQAMVEQLRYPNVHTYWFIFALRNMFVSEEw--Gdqlle 1994 Torulaspora d...
XP_002497191 1937 LenqkmsssAVFN--TKSSYYTLLFNLIHE--GVTELKYQIIQVMIEQLRYPNSHTYWFSYALKNMFVSDDw--Geqrse 2010 Zygosaccharom...
CCH61566     1916 IenertsssAVFN--TKSSYYSLLFNLINNdtTTIELKYQIIHTIIEQLRYPNIQTYWFNFVIINLFVSDEwSDGnkkqe 1993 Tetrapisispor...
5AJD_A        411 IeykrtssnAVFN--TKSSYYTLLFNLIQN--GSIEMKYQIILSIVEQLRYPNIHTYWFSFVLMNMFKSDE-WNDqk-le 484 
4C0D_A        741 IQEQITRVLLERLIVNRPHPWGLLITFIELIKNPAFKFWNHEFVHCAPEIEKLF 794 
CCK72050     2006 VQELILRCILERIIVNKPHPWGVSILTTQLLNQDEVNLLELEFIKTVPEIEKML 2059 Kazachstania naganishii CBS 8797
XP_003959459 2038 IQEIMLRCLLERVIVNKPHTWGIIVFFTQLLQNKEVNILELDFIKNIPEIENIL 2091 Kazachstania africana CBS 2517
P25655       2022 VQEIILRNFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLIL 2075 Saccharomyces cerevisiae S288C
CCE64445     1841 IQEIILRNLLERIIVNKPHPWGVTVLFTELLHNKDTKLIDLNCVKSVPEIEKII 1894 Tetrapisispora phaffii CBS 4417
XP_001643066 1670 IQEIILRNIFERIIVNKPHPWGVTVLFTQLLNLNNVKLLSLPCVKKVPEIENIL 1723 Vanderwaltozyma polyspora DSM 70294
CCE90120     1995 VQEIILRNLLERIIVNRPHTWGISVIFTQLITSKEINLLDLPFVKKLPEVRNLL 2048 Torulaspora delbrueckii
XP_002497191 2011 VQEIILRNLLERIIVNRPHAWGVSVLFSQLLRGKDVNLLELPFVEKFPEINVIL 2064 Zygosaccharomyces rouxii
CCH61566     1994 IQELILRNILERIIVNKPHCWGIIVLVMSLLKSSEVDLLSYSFIKEIPEVENMF 2047 Tetrapisispora blattae CBS 6284
5AJD_A        485 VQEIILRNFLKRIIVNKPHTWGVSVFFTQLINNNDINLLDLPFVQSVPEIKLIL 538 
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap