2HQS


Conserved Protein Domain Family
TolB_N

?
pfam04052: TolB_N 
Click on image for an interactive view with Cn3D
TolB amino-terminal domain
TolB is an essential periplasmic component of the tol-dependent translocation system. This function of this amino terminal domain is uncertain.
Statistics
?
PSSM-Id: 397940
Aligned: 105 rows
Threshold Bit Score: 60.327
Threshold Setting Gi: 67461991
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2HQS_D             2 VRIVIDSGVDSGRPIGVVPFQWAGPG---AAPEDIGGIVAADLRNSGKFNPLDRARLPQQPGS----AQEVQPAAWSALG 74  Escherichia...
WP_011697626      45 FELDLTNPNFQRIAIAIPDFKRQSSEq-tQLAREMGETLAGDLDFSGIFRPLDPKGFLEDPQTmglnAPEIKFPDWRRLG 123 Syntrophoba...
Q3A097            21 AQVEIRAPGQQTIAVANTQLVPLSGTplpAIAAELHDVMAADLELSGLFRQLDPAAFLDDARRpgltSSRVDFNQWALLG 100 Pelobacter ...
jgi:Gura_0203     22 GYLEVTAPGNRQMQLAVAQPVSLFGGpsaDIAKGISEVFSFDLTLAGPFAVMPTPPAESKSGIr---PGEFDFAPWQAAG 98  Geobacter u...
WP_012471493      25 NYIEVTAAGNRLLKLAVVPPQPMGTVirpELANETAELHAFDLTMSGLVAAERRDAAPLVHGLa---LTPVDFVPWLSAG 101 Geobacter l...
jgi:Ppro_3323     31 GYIEITAPGNRQLRMAVDVPRSLEAAsspEKAREMGEVIAFDMNMSGLCLAEIKEQFNLSGALl---FAEADFNSWLKGG 107 Pelobacter ...
Q1D0D0            21 pTIEISGANFRPLPVAVPAPLTQNDGa-kALVAPFDSAFSFDLTASGILQVLDRKGFTADAKEgm-aAASINFSRWADVG 98  Myxococcus ...
Q7MA16            19 ATLEVVKKFANMPSIIVEDSSTREVEr--GLTLRVYKMLVGDLKVSSHFNVQEGGASSF--------DMVMDYGAYRQKK 88  Wolinella s...
jgi:Anae109_0703  28 PTLTIGSPSFQPLPIAVAQFQGEGGD---ARAAGVTEVVRGDLSLSGLFDVLDPRGFLADPSEgw-aAPTIRFARWSDVG 103 Anaeromyxob...
Q2INP9            26 PTIVVGSPDFRPLPIAVAAFQGEGDAg--AAATQTAEVVRADLVLSGLFDVLDPRGFLADPAEgf-aAPSIRFARWADVG 102 Anaeromyxob...
2HQS_D            75 IDAVVVGQVTpNPDGSYNVAYQLVDTGGAPGT 106 Escherichia coli
WP_011697626     124 ADYMVRGNYLvQGGT-VKIEARLFDVAAGRPV 154 Syntrophobacter fumaroxidans
Q3A097           101 AEILIKGGYQ-LQGERLLVDFRLYDVVHRRLL 131 Pelobacter carbinolicus DSM 2380
jgi:Gura_0203     99 ANLLVKSGYTvSADS-LTIEFRLYDVARGKEL 129 Geobacter uraniireducens Rf4
WP_012471493     102 YDLLIRGEYElRGQE-LTLEFRLYDVVAKKLL 132 Geobacter lovleyi
jgi:Ppro_3323    108 YDLLVRGEYSvKGDD-LTVEFRLFDLANRKMM 138 Pelobacter propionicus DSM 2379
Q1D0D0            99 AEALVKVSLA-QDGGVLRGELRLFNVGTGREd 129 Myxococcus xanthus DK 1622
Q7MA16            89 VDLVAKVKAGrEGSG-ILAELRLYDVNSGDSV 119 Wolinella succinogenes DSM 1740
jgi:Anae109_0703 104 AEGLVKARMRqAGDE-LEAELHLYEVRAGREV 134 Anaeromyxobacter sp. Fw109-5
Q2INP9           103 ADGLAKARVRrGPGG-LEGELHLYEVRAGREV 133 Anaeromyxobacter dehalogenans 2CP-C
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap