3ZN3


Conserved Protein Domain Family
ANAPC8

?
pfam04049: ANAPC8 
Click on image for an interactive view with Cn3D
Anaphase promoting complex subunit 8 / Cdc23
The anaphase-promoting complex is composed of eight protein subunits, including BimE (APC1), CDC27 (APC3), CDC16 (APC6), and CDC23 (APC8).
Statistics
?
PSSM-Id: 397937
Aligned: 68 rows
Threshold Bit Score: 102.295
Threshold Setting Gi: 340504070
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3ZN3_A         5 EIRNCLLKCISECSERGLVYAVRWAAEMLNGMNPIEMEHIPFSstptGEFDLDPDM------------------------ 60  fission yeast
XP_011277505   6 QLRSHLRSSISTLSSLKLYQAAKWSAEALNGMKIDDDEESDVDliqdEETTPIPTI------------------------ 61  Wickerhamomyces...
CAR30048      12 ELKLELRESAVQLSRLKLYNSSKWSAEALCGMCEIPSVPVMKTfmknD---DSPLRnrsniqf----------------- 71  Lachancea therm...
EDO19222      12 DIRNNLRVSSKELCELKLYKSSKWSSEALCGMVHLPEGRRLSGggvgDDGYESPLKsrknhdgnv--------------- 76  Vanderwaltozyma...
XP_003957512  13 DTKSSLRRSVLELSQWKLHKSAKWSAEALQGMADQQVPRYVVDp------dESPIRddsvksr----------------- 69  Kazachstania af...
CCC69720      12 DIRRNLRRASQDLSKWKLYKSAKWAAEALCGMGPPSTATLEPVd-------ESPLRnraskg------------------ 66  Naumovozyma cas...
CCD23995      14 DIKINLRRSASDLSHWKLYKSAKWSSEALIGMCDISPFLSNKAdpvnI-TYESPLRnrtgmgrlgndgk----------- 81  Naumovozyma dai...
Q6FQZ3        10 DVRWNLRKAALEMSMMKLNGSSKWAAEALNGICEEVTVDQLGL--------ESPMDklgkhieikepgnski-------- 73  [Candida] glabrata
CCH59613      12 EIRQNLRKSAAELSQMKLYNSAKWSAEALVGMCESISYPDIESsgsgIPAYDSPLRgrvqghnnnhsnysnnhtntsnns 91  Tetrapisispora ...
ESW95915       8 QLRFALIESSKVLQSLHLYHGAKWSSEALNGLCPLTNDQKAAVfqqsQQRTPISFLpq---------------------- 65  Ogataea parapol...
3ZN3_A        61 ----------------------------------ANEKLLEVEEKNIYLLAKSYFDCKEFERAAYTLQNCKSSKSIFLRL 106 fission yeast
XP_011277505  62 -----------------------------------YQIRLNSKDHDQFELAKTYFDCKEFDRCYTILKNSTNSNCIFLKL 106 Wickerhamomyces...
CAR30048      72 ---------------------------eqqespqKHLSGMESSEYDLYLLASTLFECKEYDRCAYYLADSKHPELKFLKL 124 Lachancea therm...
EDO19222      77 -------------------------cgvfegssrCLSNQLTPEEYDLYLLGSSLFDCKEFDRCSYFLKEVSNPKLKFLKL 131 Vanderwaltozyma...
XP_003957512  70 ----------------------------mnyelpQVNAGMSEQEYDLYLLASSLFDSKEFDRCSYFLKDVVEPRLKFLKL 121 Kazachstania af...
CCC69720      67 ----------------------------knmeeeRKKKSLSEDEHDLYLLASSLFDCKEFDRCTYFLKDVTNPCLMFLKL 118 Naumovozyma cas...
CCD23995      82 -----------------------tnnngkmamdydpRYGMNDDEYDLYLLAVSLFDCKEFDRCCYFLKDVKHPCLKFLKL 138 Naumovozyma dai...
Q6FQZ3        74 -------------------sgdipnknflsfhdnKSNFYFNEKEYDKYLYVSTMFDNKEFDRCAFYLEDATNPSLKFLKL 134 [Candida] glabrata
CCH59613      92 tknnmnrmmnskingnntsnnanennmkfdtlskSNTFGFTTSENDLYLLASSLFDLKEFDRAAFFLKNATNPCLVFLRL 171 Tetrapisispora ...
ESW95915      66 ---------------------------------hSQDDFLEFTEQDKLLMATSYFSFKEFDRCAHVLKDCASPRGLFLKL 112 Ogataea parapol...
3ZN3_A       107 YSKYLAGEKKSEEENETLLNTNLT-LSSTNRE 137 fission yeast
XP_011277505 107 YSLLISGDLKREQESEGALGSND--LNSSNKS 136 Wickerhamomyces ciferrii
CAR30048     125 YSKYLSWDKKTQENMESSLAPRSSkQNTGFRE 156 Lachancea thermotolerans CBS 6340
EDO19222     132 YCDYLSWDKKSQEKMESLLTTGKI-PSSKNND 162 Vanderwaltozyma polyspora DSM 70294
XP_003957512 122 YCSYLSWDKKTIESTETMLMVGES-SRIQSPD 152 Kazachstania africana CBS 2517
CCC69720     119 YSQFLSWDKKTQESLESVLTTGKLsKNSSNNN 150 Naumovozyma castellii CBS 4309
CCD23995     139 YSKFISWDKKNQESVESVLTVGKS-KNIPTGI 169 Naumovozyma dairenensis CBS 421
Q6FQZ3       135 YSMYLSWDKKTQESLENVLTIEK---NSVKYD 163 [Candida] glabrata
CCH59613     172 YSMYLSWDKKVQESAESLLLTGKR-PNKSNEQ 202 Tetrapisispora blattae CBS 6284
ESW95915     113 YALYLSGEKTKYDETGGVLGQQD--GKVQNQK 142 Ogataea parapolymorpha DL-1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap