5AP8


Conserved Protein Domain Family
Ribo_biogen_C

?
pfam04034: Ribo_biogen_C 
Click on image for an interactive view with Cn3D
Ribosome biogenesis protein, C-terminal
This family represents the C-terminal domain of some putative ribosome biogenesis proteins in archaea. It has also been identified in the eukaryotic protein Tsr3, which is involved in ribosomal RNA biogenesis.
Statistics
?
PSSM-Id: 397928
Aligned: 178 rows
Threshold Bit Score: 117.917
Threshold Setting Gi: 383795715
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5AP8_B         36 VVLDPFAQITLSNKDKDIVRRIGITIVDTSWNN------T--SQSEFKNIrg-------ehRRIPILFAGNPIHYGIAYK 100 Saccharolobus ...
Q9HM46         40 LMLTRSADTVLSKNDRFIAERSGICVIEGSWNRedtfagLrfp----------------ygRRLPKLLAANPVNYGKLEK 103 Thermoplasma a...
Q6L1K6         44 IVLTPYSEIYLNNKDSGLYSAYGLCILETSWNS------I--NDISrirp--------lnaRRLPLLLPVNPVNYGRPGK 107 Picrophilus to...
EQB66456       46 LVLTVSSSQYLMNSDRTLILERGITAIEGSWKQ------N--NLMGetkf--------rygRILPPLLASNPVNYGKWNL 109 Thermoplasmata...
EQB68728       47 VVLRYDADRTLLPDDRSAVERKGICIIEGSWNL------G--DLLGsyrk--------gieRKLPVLMAGNPVNFGKFNK 110 Thermoplasmata...
jgi:Kcr_1134   39 IVLNPFSRVYLSPADRGA---RALVAVDASWRR------I--EEVRwpa---------glqRRLPFLVAANPINYGIPEY 98  Candidatus Kor...
jgi:Aboo_0355  44 IILSPYTRRVLSPADRRTAERQGVSAVDCSWKN------A--REVFyrlr--------gnfRRLPYLVAVNPTNWGHPWQ 107 Aciduliprofund...
ABK77844       38 ILLDPFAPRVLLPPDAGL---GPVTCIDCSWKK------AgeSFAPgmp---------gtrRRLPPLLAGNPVNYSRQNM 99  Cenarchaeum sy...
jgi:Nmar_0617  38 LVLDPFSKNTLMSKDKSLINS--IVGIDCSWNL------A--DQAFskkf-------ngikRKLPPLLAGNPVNYAKLNK 100 Nitrosopumilus...
jgi:Igag_0053  42 ILLNPIASSYLKRSDRIYIESCGIVAIDISWKQ-------------SLYLlrkalsmhtknRVLPILIAANPINYGKPFK 108 Ignisphaera ag...
5AP8_B        101 LSSIEALIATLYIVDEVEEAIKLSNVVKWGHTFIELNKELLEAY-KNKTEEDIKKIEREI 159 Saccharolobus solfataricus
Q9HM46        104 LSSIEAVAAALYIMGFQDDASAILSKYTWGQNFLQLNKNPLDEY-READPEKIPEIENAY 162 Thermoplasma acidophilum DSM 1728
Q6L1K6        108 LSSVEAAAAALYILGRHDEASKILEKFSWAQTFLSVNMMPLSDYeRCRTQEDIKKTEDMY 167 Picrophilus torridus
EQB66456      110 LSSVEAISASLIITGFRDFAERILSKFSWGHSFISLNMEILEEYaKCKSEDDIKNVVdsi 169 Thermoplasmatales archaeon E-plasma
EQB68728      111 LSSVEAVVGALFITGHIDQAKVMIGKFTWGHTFIELNMELFKSYsACQTMEDLENVylef 170 Thermoplasmatales archaeon Gpl
jgi:Kcr_1134   99 LSTVEALASALIILGYWDLSLRILNPFKWGEEFLRINEDRLKAYaRSSCEEEVRALSEKF 158 Candidatus Korarchaeum cryptofilum...
jgi:Aboo_0355 108 LSSAEALAAALYILGYKEQAHKIMNIFKWGPNFFVMNREPLEAYaNSSSWEEVLDAESEF 167 Aciduliprofundum boonei T469
ABK77844      100 LSTAEALAAALYILGRRARAEEMMDKFRWGHTFLELNRNLLDEYaSMRDESEIGPVLREY 159 Cenarchaeum symbiosum A
jgi:Nmar_0617 101 LTTVEALAASLFILGQKEQGLELLEKFKWGHTFYELNQNLFDEYlKLENEEQIELILKDY 160 Nitrosopumilus maritimus SCM1
jgi:Igag_0053 109 LSTAEAIAASLFITGFIEEANAILNEFKWGPQFLELNRYRLERYsQADSDEELDKIQKEL 168 Ignisphaera aggregans DSM 17230
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap