3AIA,2QMM,2QWV


Conserved Protein Domain Family
Methyltrn_RNA_2

?
pfam04013: Methyltrn_RNA_2 
Click on image for an interactive view with Cn3D
Putative SAM-dependent RNA methyltransferase
This family is likely to be an S-adenosyl-L-methionine (SAM)-dependent RNA methyltransferase. It is responsible for N1-methylation of pseudouridine 54 in archaeal tRNAs.
Statistics
?
PSSM-Id: 397908
Aligned: 5 rows
Threshold Bit Score: 227.79
Threshold Setting Gi: 24418785
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3AIA_A   7 MREFIFKANKTITsSDINLKDLPGsCGRLDLLCRCVSDAFFLSHDIRRDVVFYAVLYGQPNPPVCIKFVGSELKK--VSP 84  Methanocaldococcus ja...
2QMM_A   4 VRGFLIVGNKAFT-QPFSLNDLPG-AGRMDVLCRCTSQALFISHGIRRDVEVYLLLLGPPSPPKSILIKGDEVRR--MSP 79  Archaeoglobus fulgidu...
Q9HNR6   1 MRQFVVLGHDAPTtPDFPLDDLPGaAGRLDVLCRCVSAALFVSHGIRDDVEVFLVLG----DEVTVRIDAGAVQY--MHP 74  Halobacterium salinar...
Q9YDX2   1 MSLYVVISPTGRTdGNIPARGYAGpSGRLDVIARAYNAILEP------NATLAALLMGGPLPPRLLIAPLSCKDI--VRS 72  Aeropyrum pernix K1
2QWV_B   8 xRSFILRARSAPTdSQRLLDEIGG-KCHTEILAHCXXNSLFTAQSHREDVVIHLVLESTRDYSRTITVEANEISDvgGFH 86  Vibrio cholerae O1 bi...
3AIA_A  85 DERNIAIFIKKALkKFeeldeEQRKDWNQSTPGIYVRRLGFRNLVLEKLEEgKNIYYLHMNGEDVENVDIE----NPVFI 160 Methanocaldococcus ja...
2QMM_A  80 DERNVAGHIKKAL-AV-----ECGKSWKKVHSGVYVSRKGLEELIEELSEK-YSIIYLKEDGVDISNAQLPp---NPLFV 149 Archaeoglobus fulgidu...
Q9HNR6  75 DERNVAGLLKQALdAKt---eAIGHQEASSSPGIHVSKRGFEAVLDAVSG---PVVALHEDG-DALAAVDPl--aDPVFV 145 Halobacterium salinar...
Q9YDX2  73 -ERSFMIEASRALrGR--------------RSCFTVNDEGVEALASLLRRf-KPRILLAEKGGDISSHWGEmcssSPTFI 136 Aeropyrum pernix K1
2QWV_B  87 EAALIALLVKALDaSVg----XGKEQTRVVQPGLTVRTISFEALLGELAEH-HSLYXXDKKGDSIRDIKIGp---NPCFI 158 Vibrio cholerae O1 bi...
3AIA_A 161 IGDHIGIGEEDERFLDEIK--AKRISLSPLELHANHCITIIHNVLDKKRI 208 Methanocaldococcus jannaschii
2QMM_A 150 IGDHEGLTEEQEKVVERYA--ALKLSLSPLSLLAEQCVVIAHHHLDRLQF 197 Archaeoglobus fulgidus DSM 4304
Q9HNR6 146 LSDHRDFTAAEASLLADAS--DHRVRVGPTVLHADHAITVAHNHLDTAGF 193 Halobacterium salinarum NRC-1
Q9YDX2 137 AGSHLDPPHGLIKHLERSLggFLRVSVGPLSLHTDHVFLLVSALRLPMHA 186 Aeropyrum pernix K1
2QWV_B 159 LTDHIPXPKKSGNSXKRLG--VEKISLGPKXLFASQCVTLIHNEIDHQEA 206 Vibrio cholerae O1 biovar El Tor str. N16961
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap