1WVQ,1VGG,1RLH


Conserved Protein Domain Family
Adenosine_kin

?
pfam04008: Adenosine_kin 
Click on image for an interactive view with Cn3D
Adenosine specific kinase
The structure of a member of this family from the hyperthermophilic archaeon Pyrobaculum aerophilum contains a modified histidine residue which is interpreted as stable phosphorylation. In vitro binding studies confirmed that adenosine and AMP but not ADP or ATP bind to the protein.
Statistics
?
PSSM-Id: 397904
Aligned: 94 rows
Threshold Bit Score: 212.715
Threshold Setting Gi: 327315497
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1WVQ_A            11 IDVPIPQGTNVIIGQAHFIKTVEDLYEALVTSVPGVKFGIAFCEASGKRLVRHEANDEELRNLAIDLCKKIAAGXVFVIY 90  Pyrobaculum...
WP_015190276       6 IPVQIPEGSNVILGQSHFIKTVEDLYEIMTENSSQIKFGVAFCEASGPCLIRATGNEQVLQAAAINNAKAIAAGHSFIIV 85  Gloeocapsa ...
Q7NIY7             6 VTMVIPEDCNLILGQAHFIKTVEDLHEIFVGISAQVKFGIAFCEASGPCLIRLSGNDAPLQEVATANAQALGAGHCFVIL 85  Gloeobacter...
WP_015170120       6 VPVEIPEGCNVILGHSHFIKTVEDLHEILVGISGQVKFGLAFCEASGPCLIRVSGNDDGLQQAAVGNAQAIAAGHSFVIL 85  Geitlerinem...
jgi:Cylst_1834     6 VAMQIPEGCNLILGQTHFIKTVEDLYEIMVGISSQVKFAIAFCEASGACLIRIAGNDSLLQQVAIENALAIAAGHSFIIL 85  Cylindrospe...
jgi:Cal7507_5779   6 VAMRIPEGCNFILGQAHFIKTVEDLYEIMIGISSQVKFGIAFCEASGACLIRTTGSDRSLQDIANQNAQAIAAGHSFVIL 85  Calothrix s...
WP_015145883       6 VPLEIPQGCNLILGQSHFIKTVEDLYEVMVGTSGQVKFGLAFCEASGQCLIRVAGNEEKLQEVAIKNAQAIAAGHSFIIL 85  Pleurocapsa...
WP_009547722       6 iPLEIPSGSNLILGQSHFIKTVEDLYEIMVGISSQVQFGLAFCEASGARLIRVTGNNQELQEVAVKNAQALSAGHSFIIM 85  Crocosphaer...
jgi:PCC8801_2249   6 IALQIPEGCNLILGQTHFIKTVEDLHEIMVGTSGEVKFGLAFCEASGKRLIRVSGNDPQLEAMAIKNAEAIAAGHSFIIM 85  Rippkaea or...
tgen:AM1_D0190     7 V-LHVPEHTNLILGQSHFIKTVEDLYEIMVGTCPQAKFGLAFCEASGPCLIRFAGNDPSLQDIAVSNAKKIAAGHSFILL 85  Acaryochlor...
1WVQ_A            91 IRNAWPINVLNAIKNVPEVVRIFAATANPLKVIVAEvEPERRGVVGVVDGHSPLGVETEKDREERKKFLREvVKYK 166 Pyrobaculum aer...
WP_015190276      86 MQNAYPISVLNAIKQCPEVCNIYCATANPVEAIIVE-TDQGRGILGVVDGSAPKAVETAEDVRVRHQFLRQ-VGYK 159 Gloeocapsa sp. ...
Q7NIY7            86 LKEAYPINFLNAIKQCAEVCTIYCATANPTQVIVAV-TEQGNGILGVVDGFAPRGVESPADVQQRQAFLRR-VGYK 159 Gloeobacter vio...
WP_015170120      86 LREAFPVNFLNAIKQCSEVCTIYCATANPVQAIVAE-TEQGRGILGVIDGFSPKGVEGPAEQQVRRDFLRQ-IGYK 159 Geitlerinema sp...
jgi:Cylst_1834    86 LKDAYPINFLNAIKQCPEVCTIYCATANPVEVILAQ-TAQGSGILGVIDGFSPKGIESDEDVKARQQLLRQ-IGYK 159 Cylindrospermum...
jgi:Cal7507_5779  86 LKEGYPINFLNAIKQCPEVCTIYCATANPVEVIVAQ-TQQGRSILGVVDGFVPRGLETSSDVTARQELMRQ-IGYK 159 Calothrix sp. P...
WP_015145883      86 LKDAFPINFLNSIKQCQEVCTIYCATANPVRVIVAE-TEQGRGILGVVDGFSPKGVESDEDIKVRQEFLRT-IGYK 159 Pleurocapsa minor
WP_009547722      86 LKEAFPINFLNSIKQCPEVCRIYCATANPVEVVVAE-SEQGKGILGVIDGYSPLGVETEQDIIERQEILRK-FGYK 159 Crocosphaera su...
jgi:PCC8801_2249  86 LKNAFPINFLNSIKQCQEVCTIYCATANPVEVIIAE-TAQGRGILGVVDGYTPLGLESEEDVQERKQILKK-FGYK 159 Rippkaea orient...
tgen:AM1_D0190    86 MQDAFPISVLNAIQQSPEVCTIYCATANPVEVILAK-TDQGAGVLGVIDGFSPKGVEGEEDILERQDFLRQ-IGYK 159 Acaryochloris m...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap