Conserved Protein Domain Family
OAD_beta

?
pfam03977: OAD_beta 
Na+-transporting oxaloacetate decarboxylase beta subunit
Members of this family are integral membrane proteins. The decarboxylation reactions they catalyze are coupled to the vectorial transport of Na+ across the cytoplasmic membrane, thereby creating a sodium ion motive force that is used for ATP synthesis.
Statistics
?
PSSM-Id: 397879
Aligned: 192 rows
Threshold Bit Score: 284.721
Threshold Setting Gi: 573931180
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
jgi:Amuc_0204           26 MWGIAILLLYLGVAKQYEPLLMVPIAFGALIANIpdngmlitqlnqqvissneqgevtatslnnvgylrvhvaplqqaps 105 Akker...
rhodo:RCAP_rcp00132     29 FIGLGFLLAYLGFKRTLEPLIMVPMGLGMMAVNA---------------------------------------------- 62  Rhodo...
jgi:Palpr_1268          30 LIFLGLLLMYLGKKGVLEALLMIPMGLGMATINA---------------------------------------------- 63  Palud...
WP_021988948            30 LVILGCAVIYLGWKGVLEPMIMIPMGLGMIAINC---------------------------------------------- 63  Cultu...
PRJNA63271:OPIT5_02470  30 LIFLGMLLVYLGKKGTLEPLLMIPMGLAMCAVNA---------------------------------------------- 63  Opitu...
jgi:Oter_3311           30 LMLLGMLLVYLGKKGVLEPLLMIPMGLGMCAVNA---------------------------------------------- 63  Opitu...
jgi:Clole_2003          27 LIGVGLLIFYLGAKGTLEPLVMVPMGLGMSAVNA---------------------------------------------- 60  Cellu...
WP_006521108            30 LILLGMGLVYLGAKNILDPLLMIPMGFGMASVNA---------------------------------------------- 63  Desul...
CDK97334                30 LIALGVLLIYLGKKGVLEALLMIPMGLGMATINA---------------------------------------------- 63  Magne...
jgi:CAP2UW1_3917        30 LMLLGFLLIYLGSKNVLEPLLMIPMGLGMSSVNA---------------------------------------------- 63  Candi...
jgi:Amuc_0204          106 kvpanlttpesraqyqeimqqpmqvypgsqltvskiksvresqekakadaarlgddsltvdpnlkdfqnvtedngnepvf 185 Akker...
rhodo:RCAP_rcp00132        --------------------------------------------------------------------------------     Rhodo...
jgi:Palpr_1268             --------------------------------------------------------------------------------     Palud...
WP_021988948               --------------------------------------------------------------------------------     Cultu...
PRJNA63271:OPIT5_02470     --------------------------------------------------------------------------------     Opitu...
jgi:Oter_3311              --------------------------------------------------------------------------------     Opitu...
jgi:Clole_2003             --------------------------------------------------------------------------------     Cellu...
WP_006521108               --------------------------------------------------------------------------------     Desul...
CDK97334                   --------------------------------------------------------------------------------     Magne...
jgi:CAP2UW1_3917           --------------------------------------------------------------------------------     Candi...
jgi:Amuc_0204          186 lltngegttvvrqqgvnyfdtsgnripvdlktqkleplvvsaagkyvavgqhtqellvtsihgGLY-------------- 251 Akker...
rhodo:RCAP_rcp00132     63 ---------------------------------------------------------------GVMileggqvgtlvisp 79  Rhodo...
jgi:Palpr_1268          64 ---------------------------------------------------------------SLMflphgvpggfveng 80  Palud...
WP_021988948            64 ---------------------------------------------------------------GTLmmpegglgnlfldp 80  Cultu...
PRJNA63271:OPIT5_02470  64 ---------------------------------------------------------------GVLfldpttaghivhgs 80  Opitu...
jgi:Oter_3311           64 ---------------------------------------------------------------GVLfldpttaaavteap 80  Opitu...
jgi:Clole_2003          61 ---------------------------------------------------------------GVLflspgqtgtifmdp 77  Cellu...
WP_006521108            64 ---------------------------------------------------------------AVLflsaqkqgtifvdp 80  Desul...
CDK97334                64 ---------------------------------------------------------------AVLfvpeggwlragpnq 80  Magne...
jgi:CAP2UW1_3917        64 ---------------------------------------------------------------GVMfldakkmgtlfvdp 80  Candi...
jgi:Amuc_0204          252 ----------------------------------------------DWIGLG-IKAEIFPPIIFLGVGALTDFGPLLAAP 284 Akker...
rhodo:RCAP_rcp00132     80 lv-----------------------------setnalmdimqinflQPIYNFtFVNSLVACMLFMGIGTMADISFILARP 130 Rhodo...
jgi:Palpr_1268          81 avqgtlf-------------------ldsmvtdvnqmfdllqidflQPVYVFtFSNGLIACLVFMGIGSLLDIGFLLQRP 141 Palud...
WP_021988948            81 la-----------------------------sdtdelmnimqidflQPIYTLsFSNGLIACFVFMGIGTLLDVGYLLQRP 131 Cultu...
PRJNA63271:OPIT5_02470  81 apladpvaqqqaaelaasgqmhgtlfmsplveeptrliglmqidflQPIFTFaFSNNLIACLVFMGIGVLLDVGFVLARP 160 Opitu...
jgi:Oter_3311           81 vasgvhttg--------------tlmmaplvqntdnlmyilqvdflQPIYTFaFSNGLIACFVFMGIGVLLDVGFVIARP 146 Opitu...
jgi:Clole_2003          78 im-----------------------------sdtdglmqilqidflQPIYTFmFSNGLIACLVFMGIGVITDVGFLLANP 128 Cellu...
WP_006521108            81 mi-----------------------------sdaaelmtilqvdflQPIYTLtFSNGLIACFIFMGIGAMTEIGYVLARP 131 Desul...
CDK97334                81 ifvdala-------------------vadnaaqttalmnilqinwlQPIYTFtFSNGLIACVVFLGIGVLLDVGYVMARP 141 Magne...
jgi:CAP2UW1_3917        81 lm-----------------------------sdpldlmnimqidwlQPIYTLtFSNGLIACLVFMGIGVLLDVGYVMARP 131 Candi...
jgi:Amuc_0204          285 -RTLLLGAAAQVGVAATFFMALFMGFTPNESASIGIIGGADGPTSIFLTMKLAPHLLGAVAVAAYTYMSLVPLIQPPIMA 363 Akker...
rhodo:RCAP_rcp00132    131 wASIAVAVCAELGTFVTLVIGYYCGLTPGEAAAVGTIGGADGPMVLFGSLMMAKNLFVPISIIAYLYLSLTYAGYPYLVR 210 Rhodo...
jgi:Palpr_1268         142 fTSMLLALCAELGTFVVVPIAQAMGLTAQEAASIAMVGGADGPMVLFTSLSLAKHLFVPITVVAYLYLGLTYGGYPYLIR 221 Palud...
WP_021988948           132 fASILLALCAELGTFLTLPIASAMGLTLKEGASVAMVGGADGPMVLFTSLVLAKHLFVPITVVAYLYLGLTYGGYPYLVK 211 Cultu...
PRJNA63271:OPIT5_02470 161 fLSISMALFCELGTIVTFPIAVAMGFTYGEAASIALVGGADGPMVLFGALKMAKHLLVPITIIAYLYLGLVYGGYPYLIR 240 Opitu...
jgi:Oter_3311          147 fLSMFLALCAELGTVATFPIAVAMGLNYGEAASIAMVGGADGPMVLFTSLTLAKDLFVPITVVAYLYLGLCYGGYPYLIR 226 Opitu...
jgi:Clole_2003         129 fTSMFIAMCAELGTVATFPIAKCFGLTNGEAAAIAMVGGADGPMVLYTSLTLAKDLFVPITIVAYLYLSLTYGGYPYLVR 208 Cellu...
WP_006521108           132 fSSMVIALCAELGTIATFPIAVAMGLSYSEAASIAMVGSADGPMVLYTSLMLAKDLFVPITIVAYLYLSLTYGGYPYLIK 211 Desul...
CDK97334               142 fQSMILALFGELGTIAVYPIAIALGLTPGQAASVAIIGGADGPMVLFTSLSLARELFVPITVVAYLYLGLTYGGYPYLIR 221 Magne...
jgi:CAP2UW1_3917       132 fQSIFIALFAELGTIAVFPIAIWLGLNPGQAAAVATIGGADGPMVLFTSLVLAKDLFVPITVVGYLYLGLTYGAYPYLIK 211 Candi...
jgi:Amuc_0204          364 LLTTKKERLIRM---K-SLR-TVSKSEKLFFAVLVTIVTILLIPDASPLIGMLMLGNFLRECKV-TERLVQASQNEIINI 437 Akker...
rhodo:RCAP_rcp00132    211 WLIKEEHRAIEV---DyDFP-DVTPQAKFIFTVVAAGLLCLLLPVATPLILSFFLGVAIKE--AeIEPYQKFLENTVTYA 284 Rhodo...
jgi:Palpr_1268         222 LLIPKKLRAIKIdksKeKPKkPISASTKLAAAGILCVVLCLLFPVASPLFFSLFLGISIKE--AkLTHIHDFISGPLLYG 299 Palud...
WP_021988948           212 LLVPKRFRAIKIe--EkKVPkNYAPKVKLAFAVILCAVLCFLFPVASPLFLSLFIGVAVRECKEsMKHVYEFMSGPLLYG 289 Cultu...
PRJNA63271:OPIT5_02470 241 ALIPAKLRGLKM---PaRPVaKITSGEKLAFAVVACTVLCLLFPSAAPLFFSLFLGVAVRE--AgLKVFSSMIESVFLYG 315 Opitu...
jgi:Oter_3311          227 ALVPAKLRGLKM---PaKAPaKITSDEKLAFAVIGSTVLCLLFPSAAPLFLSLFVGVAVRE--AgLQYFINFIDGPLLYG 301 Opitu...
jgi:Clole_2003         209 LLIPKELRGIAIq-pPkVPKkTITKKQKLTFAIVTNTVLCLLFPVAAPLFLSFFLGVVIRE--VgLDKYVKLIENGFLYG 285 Cellu...
WP_006521108           212 IMIPKRLRGIKM---DlSNIpTVTPGEKIAFSIITCTVLSLLFPVAAPLFMSFFLGVTVRE--AnLKHYVSFLEGPLLYG 286 Desul...
CDK97334               222 LLIPARLRALPMp--MeKPRkPITSGQKIAFSVTLCILLSLLFPVASPLILCLFLGVIIRE--SnLVPYMDLLGGVFLYG 297 Magne...
jgi:CAP2UW1_3917       212 WLVPERIRGISM---AsDRGpKISRSQKLTFAVVACTLLCLLFPVAAPLFFSLFLGVAVRE--SgIEPFTKLLGEVFLYA 286 Candi...
jgi:Amuc_0204          438 VTIFLGTSVGLTMQGDRFLQSETLLIILLGIVAFGVATAGGVIAAKIMNLIWrKNPVNPLIGSAGVSAVPMAARVSHNVG 517 Akker...
rhodo:RCAP_rcp00132    285 STLLLGLVLGTLCEAGTLLDPQVALLLILGITALAVSALGGIGGGYLVWKLS-KGNYNPVIGIAGVSCMPSTAKIAQKEA 363 Rhodo...
jgi:Palpr_1268         300 STFFLGLTLGVLCEAHLLLDPRILKLLVLGILALLFSGIGGIIGGYIMYFIK-GGNFNPTIGIAGVSCVPSTAKVAQKEV 378 Palud...
WP_021988948           290 STFMLGLLLGVLCDAHLLMSPVILKLLILSVVALLLSGIGGIIGGYIMYFLK-KGNYNPVIGIAAVSCVPTTAKVAQKLV 368 Cultu...
PRJNA63271:OPIT5_02470 316 ATMFLGVLLGIMCEASTILDPKVVLLLILGILSLLLSGVGGIIGGYVAYLAS-GRKINPVIGIAGVSCVPSTAKVVQKEV 394 Opitu...
jgi:Oter_3311          302 STMFLGLLLGVLCEASTILNPKVLILLVLGILALLLSGIGGLIGGYLAYFFS-GRKINPVIGIAGVSCVPSNAKVAQKEV 380 Opitu...
jgi:Clole_2003         286 GTFFLGLLLGVLCEASTLLNPKVLILLVLGMVALLLSAIGGIIGGYIVYWIS-KKNFNPTIGIAGVSCVPSTAKIAQKEV 364 Cellu...
WP_006521108           287 STFFMGILLGVLCEANTIMNPKVLILLVLGILALLLSGIGGIIGGYLMYFIS-KGKFNPVIGIAGVSCIPTTGKVAQKAA 365 Desul...
CDK97334               298 GTFFLGLLLGVLCEARLILDPQVLVLLLLGMLALLISGIGGIIGGYVLYFAS-GRKFNPVIGIAAVSCVPTTAKVAQKEV 376 Magne...
jgi:CAP2UW1_3917       287 ATFFLGLTLGVLCEANTLLEPTVLKLLLLGMLALTISALGGLVGGYILYFWS-GGKYNPIIGIAGVSCVPTTAKIVQKVA 365 Candi...
jgi:Amuc_0204          518 QKYDPSNYLLMHAMGPNVAGVIGTAVIAGYYIAT 551 Akkermansia muciniphila ATCC BAA-835
rhodo:RCAP_rcp00132    364 FEANPHAMIMPLAMGASICGVIVSAIAVGVFAST 397 Rhodobacter capsulatus SB 1003
jgi:Palpr_1268         379 TKSNPNSMILPEALGANICGVITSAIIAGLYINF 412 Paludibacter propionicigenes WB4
WP_021988948           369 SKDNPDSFVLGHALGANISGVITSAIIAGIYTTi 402 Culturomica massiliensis
PRJNA63271:OPIT5_02470 395 SKARPDVIVLPEALGANISGVITTAILTGIYVTL 428 Opitutaceae bacterium TAV5
jgi:Oter_3311          381 FKARPDSIILPEALGANISGVITTAILTGIYVTL 414 Opitutus terrae PB90-1
jgi:Clole_2003         365 SKVNKYSFIIQYAMGANICGVITTAILTGIYVTI 398 Cellulosilyticum lentocellum DSM 5427
WP_006521108           366 TEANPQSLILPYTIGANISGVITSAILTGVYVTL 399 Desulfallas gibsoniae
CDK97334               377 TAANPGVVVMPHALGASISGVITTAILAAIYVTV 410 Magnetospirillum gryphiswaldense MSR-1 v2
jgi:CAP2UW1_3917       366 SSANAGAIVMPQALGANISGVITTAIIAATYVAL 399 Candidatus Accumulibacter phosphatis clade IIA str....
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap