2F9Z


Conserved Protein Domain Family
CheD

?
pfam03975: CheD 
Click on image for an interactive view with Cn3D
CheD chemotactic sensory transduction
This chemotaxis protein stimulates methylation of MCP proteins. The chemotaxis machinery of Bacillus subtilis is similar to that of the well characterized system of Escherichia coli. However, B. subtilis contains several chemotaxis genes not found in the E. coli genome, such as CheC and CheD, indicating that the B. subtilis chemotactic system is more complex. CheD plays an important role in chemotactic sensory transduction for many organisms. CheD deamidates other B. subtilis chemoreceptors including McpB and McpC. Deamidation by CheD is required for B. subtilis chemoreceptors to effectively transduce signals to the CheA kinase. The structure of a complex between the signal-terminating phosphatase, CheC, and the receptor-modifying deamidase, CheD, reveals how CheC mimics receptor substrates to inhibit CheD and how CheD stimulates CheC phosphatase activity. CheD resembles other cysteine deamidases from bacterial pathogens that inactivate host Rho-GTPases. Phospho-CheY, the intracellular signal and CheC target, stabilizes the CheC-CheD complex and reduces availability of CheD. A model is proposed whereby CheC acts as a CheY-P-induced regulator of CheD; CheY-P would cause CheC to sequester CheD from the chemoreceptors, inducing adaptation of the chemotaxis system.
Statistics
?
PSSM-Id: 397877
Aligned: 296 rows
Threshold Bit Score: 72.4932
Threshold Setting Gi: 301166386
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2F9Z_D          48 MLPDS-----GGKtdkpGKYADTAVKTLVEELK-KMGAKVERLEAKIAGGASMF--------ESKGMNIGARNVEAVKKH 113 Thermotoga ma...
jgi:Selin_1678  50 LMPSIgqastTTP----LKYADGCVRFLHDAFR-SRGVKPHELTVSVFGGSRManq----prRHAWISVGELNVEVTLTL 120 Desulfurispir...
B3E7P9          54 MLPLW-----NGEglatPKYGSIAMERLLEQVL-AIGARKEHLVAKVFGGANLLstss------aacpIGERNIELAMTQ 121 Geobacter lov...
jgi:Spith_0109  46 LLPVA-----PTDeqrsTKYGDVAIRVLLSKFLgKAGSRKEDLLASVIGGAfvv------fdEREIFFVGDRNVEVALRL 114 Spirochaeta t...
Q5NRF0          59 LLAEPsg--sDHDpnslKRYGVYAMEVLINAML-AKGAHRNRLRARLYGGATMRsgf---------gdIGIKNAEFARRF 126 Zymomonas mob...
CCA92686        56 LLPEPps--gRSPgevdVHYGVYLMEMLINEML-SYGAHKNRLRAHLYGGANIRagm---------qqIGTANAEFARSF 123 Novosphingobi...
WP_013135567    73 LLPTT------SNsnedMKYGLYSVEAMLNEMY-KLGCQKKDLRAKISGGADIMql-----maSSINSIGHRNVEFAKDF 140 Arcobacter ni...
WP_013007925    47 LLPQFns--yNSTsyniTAFADTGLEYMITNMQ-KFSNEQLDLEAVIAGGADLs--------GSNYFNIGEKNYLAVKNF 115 Deferribacter...
CBW25962        48 LLPTS-----NGGygigAKYVNQAMDSLVALMK-VRGREQSDFIVSYAGGANMMnqiahnrdNE----IGYKNLMKLKEI 117 Halobacteriov...
WP_015392518    47 LLPNAst-dvDDEayrtAKYADRAVYNVINEMKlKYNCNLKDFKISLYGGVDSe--------LEDRFKVGERNLTVIKEI 117 Clostridium s...
2F9Z_D         114 LKDFGIKLLAEDTGGNRARSVEYNIETGKLLVRK 147 Thermotoga maritima MSB8
jgi:Selin_1678 121 LRELGYPISHQETGGINGRKVFINCASGEVLLKR 154 Desulfurispirillum indicum S5
B3E7P9         122 LEEWRIAVVATDLGGRVGRKIIMNTMTGVVLLGR 155 Geobacter lovleyi SZ
jgi:Spith_0109 115 LKEYGVYVLQMNTGGDYGRRVLFEPHTNKLVVEQ 148 Spirochaeta thermophila DSM 6578
Q5NRF0         127 LQDEHILLNAEDIGGTTARRVDFCPALGLARCRH 160 Zymomonas mobilis subsp. mobilis ZM4 = ATCC 31821
CCA92686       124 LRSERIELVREDLGGANARRVDFRPASGKVRCRT 157 Novosphingobium sp. PP1Y
WP_013135567   141 CKSEGFKILSEHTRGDHARLILM-TNDFETFIKV 173 Arcobacter nitrofigilis
WP_013007925   116 LQKNNIKIKYENCLGNHARTLTFNTKDYTFEVAK 149 Deferribacter desulfuricans
CBW25962       118 LSSYDFKVKELDCGDHCGRQMSILSPTGEVQVMR 151 Halobacteriovorax marinus SJ
WP_015392518   118 LNDMNLRYEIVNTGGRVSRTLIAHTATGEVEVKS 151 Clostridium saccharoperbutylacetonicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap