6G3U,5KVU


Conserved Protein Domain Family
IDH

?
pfam03971: IDH 
Click on image for an interactive view with Cn3D
Monomeric isocitrate dehydrogenase
NADP(+)-dependent isocitrate dehydrogenase (ICD) is an important enzyme of the intermediary metabolism, as it controls the carbon flux within the citric acid cycle and supplies the cell with 2-oxoglutarate EC:1.1.1.42 and NADPH for biosynthetic purposes.
Statistics
?
PSSM-Id: 397873
Aligned: 166 rows
Threshold Bit Score: 1315.53
Threshold Setting Gi: 501057555
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
6G3U_B            3 ITYTFTDEAPALATYSLLPIVKAFAASAGIDVETSDISLAGRILANFADRLEADQRIEDDLARLAVLATSPDANIIKLPN 82   Pseudomonas...
Q7UX35            8 IVYTHTDEAPALATRSLLPILQAFTSGSGLSFETKDISLAGRILAGFADRLPADKQVPDALAELGELVTKPEANVIKLPN 87   Pirellula sp.
WP_014436757      4 IVYTLTDEAPALATAALLPVLRAFTRHAGTHFELEDISLAGRILARFPERLTADQRQEDALAKLGAMAKQADATIVKLPN 83   Phycisphaer...
XP_002178894     76 ILYTETDEAPALATFSLYPVISKFSALANVDIVPCDISVAGRVLAAFPECLKPSQRVPDNLSYLGKKALEADCAIVKLPN 155  Phaeodactyl...
XP_003063226     18 IWWTLTDEAPALATHAFLPVVRRFCGGVGVSVESADISLASRVLAAFPERLTPAQRKTDVLAKLGELATTERANIIKLPN 97   Micromonas ...
CCB72125          6 IIYTHTDEAPALATYSFLPVVEAYASKAGVTVETRDISLAGRILAVFPEYLEEGQRIDDALAELGELAKTPGANIIKLPN 85   Streptomyce...
BAK34286          8 IVYTRTDEAPLLATYSLLPIIAAYAAKAGVDIESRDISLAARILAQFPERLGADQQVPDALAELGALAKTPEANIIKLPN 87   Microlunatu...
jgi:Intca_0556    6 IIYTYTDEAPALATASLLPIVQAFASKAGVDVETRDISLAGRILAAF-------GLADDALAELGALAKRPEANIIKLPN 78   Intrasporan...
BAJ73651          6 IIYTYTDEAPALATASFLPIVQAVTKQAGVDVETRDISLAGRILAAFPQRLTPEQQVGDALAELGGLATLPEANIIKLPN 85   Microbacter...
WP_014847502      4 IIYTLTDEAPRLATCSLLPVLQAYGRLAGIGIEGRDISLAARILARFPDFLPDDKRVSDTLDELGELTRDPLANIIKLPN 83   Pseudopropi...
6G3U_B           83 ISASVPQLKGAIAELQGLGYKVPDFP----EDPQTDEEKEVRARYAKILGSAVNPVLREGNSDRRAPAAVKAYARKHPHS 158  Pseudomonas...
Q7UX35           88 ISASIPQLVEAITELQAQGYDIPDFP----QDPKTDEEKSVRATYAKVLGSAVNPVLREGNSDRRVAAPVKAYAQKNPHS 163  Pirellula sp.
WP_014436757     84 ISASIPQLREAIAELQAAGFDVPDHH----DDPQNDEQRATNATYAKVLGSAVNPVLREGNSDRRVAGPVKAYARAHPHA 159  Phycisphaer...
XP_002178894    156 ISAPLNQLLECVNELRHKGYDVPLYP----HEPSNVEETDVKHRYDKLMGSAVNPVLREGNSDRRVAAPVKAYAQKNPHR 231  Phaeodactyl...
XP_003063226     98 VSASVPQLESCVAELKSKGYDLPKYPgkanAETMDAETLSIATRYAKVIGSAVNPVLREGNSDRRVAPPVKDFAKKNPHR 177  Micromonas ...
CCB72125         86 ISASIPQLKAAVAELREQGYALPEYP----DDPKTDEEREIRARYDKVKGSAVNPVLREGNSDRRAPASVKNYAKTHPHR 161  Streptomyce...
BAK34286         88 ISASIPQLKAAIRELQEKGFDLPDYP----DDPKSDEDRSIRARYDKVKGSAVNPVLREGNSDRRAPLSVKNYARKHPHR 163  Microlunatu...
jgi:Intca_0556   79 VSASIPQLKAAVKELQDEGHAVPDYP----DNPTTDEEKAARAAYDKIKGSAVNPVLREGNSDRRAPASVKNYARRHPHS 154  Intrasporan...
BAJ73651         86 ISASIPQLKAAIAELQAQGYDIPDYP----DEASTVEDKDVRARYDRIKGSAVNPVLREGNSDRRAPLAVKNYAKKHPHR 161  Microbacter...
WP_014847502     84 ISASAPQLKAAIAELRAKGFPLPDYP----EEPATPEEREIRSRYDRIKGSAVNPVLREGNSDRRAPESVKNYARTNPHR 159  Pseudopropi...
6G3U_B          159 MGKWSMASRSHADYMRGGDFFSSEQSITMA--KAGDVRIEFVGK----DGKVE-VKKQLSLQEGEVLDSMFMSCGKLRDF 231  Pseudomonas...
Q7UX35          164 MGDWTADSKSHVAHMSEGDFYGSEKSVILD--SDDSLRIEHVDQ----DGNVTvLRDGLTVIAGEIVDSARLSVRQLRAF 237  Pirellula sp.
WP_014436757    160 MGAWSQDSKSHVSHMAGDDFYGSEQSVTLA--EPTTVRIQLVGE----SGETRvLREGLTLEAGEVLDSATMSVAALRSF 233  Phycisphaer...
XP_002178894    232 MGLWSKASRTHVAHMETGDFYETEQSAVMA--LPTSVSIVLATK----NEGEIvLKAETPLEEGEVVDASRMSVKSLRDF 305  Phaeodactyl...
XP_003063226    178 LADWRADSSTRVASMSDGDFYGSEKSWTNEsrEPATLRVELHAKgdggGGVIQtLKRSVVALPGEIVDVATMSAEKLAAF 257  Micromonas ...
CCB72125        162 MGAWTADSKTNVAHMTGDDFRSTEKSAVVA--EAGSLRIELAGD----DGTTTvLRESVPVLAGEVVDASVMRVAALREF 235  Streptomyce...
BAK34286        164 MGAWSGDSKTNVAHMTADDFRSNEKSVVIP--ADTSLRIALVEE----AGAETvLRESVPVLAGEVVDATVLRVAALRAF 237  Microlunatu...
jgi:Intca_0556  155 MGAWSPDSKTNVATMDADDFAHNEKSVILA--QDDTLRMEHVAA----DGTTTvLKESLPVLAGEVVDATFMNAAALRQF 228  Intrasporan...
BAJ73651        162 NKAFAEGSKTRVATMGHDDFFSNEKSVVIA--DDDVLTIQHVAA----DGTTTtLKEGLKVLQGEIVDATFLSAAALDAF 235  Microbacter...
WP_014847502    160 LGAWAPDSRTRVATMASGDFRHNERSVVLA--GGDVLTIRHVAG----DGTVTvLRDGLETLPGEVVDATVMRAAALDEF 233  Pseudopropi...
6G3U_B          232 FEKTLQDCKETGVMWSLHVKATMMKISHPIVFGHAVSVYYKDVFDKWGQLFEELGVNPNNGISSVYDKI-KSLPASQQEE 310  Pseudomonas...
Q7UX35          238 YAEQIADAKSTGVLFSLHLKATMMKVSDPILFGHCVAVMYDRLFQEHGDVLTAAGVDPDQGLASVFAKV-QDLPSDQRAL 316  Pirellula sp.
WP_014436757    234 FREQIADAKQQGVLFSLHMKATMMKVSDPIIFGHAVEVFYGPVLEKHADALAAAGFEPDNGIGDLHARL-DKLPDSTRSQ 312  Phycisphaer...
XP_002178894    306 YEREMQDAKDSELMLSLHLKATMMKVSDPIMFGHAIRVFFQDAFDKHGEVLASIGANPNGGLGSVYETIkSKLPADQAAT 385  Phaeodactyl...
XP_003063226    258 AEETLRQAAKDDVMVSLHLKATMMKVSDPVLFGTVVRTYFADAFEKHASALESVGANADNGLGAVLDAI-KNLPDADRAE 336  Micromonas ...
CCB72125        236 LAAQVARAKAEGVLFSVHLKATMMKVSDPIVFGHVVRAFFPKTFAKYGEVLASAGLTPNDGLGGIFKGL-EGLPEG--AE 312  Streptomyce...
BAK34286        238 LTEQIARAKAENVLLSVHLKATMMKVSDPIIFGHAVRAFFPEVFETYGDALATAGLSPNDGLGAILAGL-DALPEG--PE 314  Microlunatu...
jgi:Intca_0556  229 LAAQVQRAKDEGVLFSVHLKATMMKVSDPIMFGHAVRAFFPDVFETYAAELASVGASPNDGLGAVLSSI-EALPQDKRAE 307  Intrasporan...
BAJ73651        236 LADTLEQAKADDVLYSVHLKATMMKVSDPIIFGHVVKAFFADVFDRHGDALAAAGLTPNDGLGSILAGL-SNVEGG--DG 312  Microbacter...
WP_014847502    234 LAGQVEAAKREGLLFSVHLKATMMKVSDPIIFGHVVRAFIGPVLERHGDALAAAGLSPDDGLGAILAGL-GNLPEG--EE 310  Pseudopropi...
6G3U_B          311 ILHDIHEVYSH--RPEMAMVDSVKGITNLHIPSDVIVDASMPAMIRNSGQMWGKDGKQKDTKAVMPESTYARIYQEMINF 388  Pseudomonas...
Q7UX35          317 VEGTLVEIQSN--LPEIAMVDSDKGITNLHVPSDVIIDASMPAAIRAGGKMWGADGKLHDMKAVIPDRCYAGVYQATIDD 394  Pirellula sp.
WP_014436757    313 IQAQLEELYAE--RPPLAMVDSDRGITNLHVPSDVIIDASMPAMIRNGGRMWGPDGEAADTKAVIPDRSYAGVYEETIQH 390  Phycisphaer...
XP_002178894    386 IQADFEACFED--RPWLAMVDSDKGITNLHAPNDIIIDASMPVVVRDSGKMWNKLGELEDVKCLIPDRCYATMYQEVLSY 463  Phaeodactyl...
XP_003063226    337 VEASIAATYASsnRPRVAMVDSDKGITNFHVPSDVIIDASMPAMIRDGGRMWNADGELEDVVCVIPDRSYAAVFAACVDD 416  Micromonas ...
CCB72125        313 IKASFDAELGE--GPALAMVDSDRGITNLHVPSDVIVDASMPAMIRTSGHMWGPDGKEADTLAVLPDSSYAGVYQAVIDD 390  Streptomyce...
BAK34286        315 IKAAIDRGFAE--GPALAMVDSDRGISNLHVPSDVIVDASMPAMIRTSGHMWGPDGAEADTLAVLPDSSYAPIYQVVIDD 392  Microlunatu...
jgi:Intca_0556  308 IEAAFEKGFAE--GPAIAMVNSDKGISNLHVPSDIIVDASMPAMIRTSGHMWNAAGEEEDTLAVLPDSSYSGIYQVVLDD 385  Intrasporan...
BAJ73651        313 IASEIRDALAS--GPRLSYVNSDKGITNLHVPSDVIVDASMPALVRNGGKLWGVDGGEDDTLAVIPDSSYAGVYQATIED 390  Microbacter...
WP_014847502    311 IRSGIEAALAE--GPALAMVDSGRGITNLHVPSDVIVDASMPAMIRNSGHMWGPDGTEADTLAVLPDSSYAGVYQAVIDD 388  Pseudopropi...
6G3U_B          389 CKTNGAFDPTTMGSVPNVGLMAQKAEEYGSHDKTFEMTADGTMRVVL--ADGSVLMQHKVETGDIWRACQTKDAPIRDWV 466  Pseudomonas...
Q7UX35          395 CIANGKFDVTQMGSVANVGLMAKKAEEYGSHDKTFRVPADGKVRVVN--SAGTELMSHDVEKGDIWRACQTKDVAVKDWV 472  Pirellula sp.
WP_014436757    391 CREHGAFDPATMGSVANVGLMAKKAQEYGSHDKTFEVPAAGRVQVVD--EGGTVLMEHAVEAGDLFRACQTKDVAVKDWV 468  Phycisphaer...
XP_002178894    464 VKTKGQFDVATMGSVANVGLMAKKAEEYGSHDKTFEIPSDGRVVVKDn-NTGEVYFEHVVNAGDVWRMCQTKDVAIRDWV 542  Phaeodactyl...
XP_003063226    417 CKKRGKFDVSTMGSVSNVGLMARKAEEYGSHDKTFVIERDGVVKVFNgdDDDDVVFEHAVSEGDLWRMCQTKDEPIRDWV 496  Micromonas ...
CCB72125        391 CRANGAFDPATMGSVPNVGLMAQKAEEYGSHDKTFEIPTTGTVRVVD--EAGEVVLQQTVSAGDIFRMCQTKDLPVRDWV 468  Streptomyce...
BAK34286        393 CRANGAFDPATMGSVPNVGLMAQAAEEYGSHDKTFEIPAEGVVKVTD--SEGNVVLEHRVSQGDIWRMCQAKDVPIRDWI 470  Microlunatu...
jgi:Intca_0556  386 CRAHGAFDPATMGSVANVGLMAQAAEEYGSHDKTFEIAADGVVRVVD--GSGTALLEHEVSAGDIWRACQTKDIPVRDWV 463  Intrasporan...
BAJ73651        391 VIANGPLDPATIGSVPNVGLMAQAAEEYGSHDKTFEIAAPGRVQVVA--SNGDVLLEHEVGAGDIWRATQTKDVAVRDWV 468  Microbacter...
WP_014847502    389 CRAHGAYDPRTMGTVPNVGLMAQQAEEYGSHDKTFHIESDGRVEVVN--SAGDVLLRHDVAAGDIWRACQTKDAAIRDWV 466  Pseudopropi...
6G3U_B          467 KLAVTRARQSDTPAIFWLDPERAHDRELRKKVELYLKDHDLTGLDISIMGYNEAIRVSMERLIRGKDTISVTGNVLRDYL 546  Pseudomonas...
Q7UX35          473 RLAVVRSRATGSPAIFWLDENRAHDQNLIGKVNEYLKDHDAAGLDIQILAPADATRHACGRAREGKDTISVTGNVLRDYL 552  Pirellula sp.
WP_014436757    469 RLAVERARESGAPAVFWLDENRAHDAELLKKVHAYLEDHDTSGLDVSVLAPAAATRHALERCRAGEDTISVTGNVLRDYL 548  Phycisphaer...
XP_002178894    543 RLAVERARATGDRTIFWLDKRRAHDASLIKKVNTYLKDHDTDGLDISIMRPVDAVRISMERATDGKNTISVTGNVLRDYL 622  Phaeodactyl...
XP_003063226    497 KLAVNRARATGAPAVFWLDPNRAHDVALTSKVRLYLADHDVADADVSIKSPVDAIDFSMTRARAGQDTISVTGNVLRDYL 576  Micromonas ...
CCB72125        469 KLAVTRARATGDPAVFWLDETRAHDAQLITKVEAYLAEHDTEGLDIRVMSPVEATKFSLERIRRGENTISVTGNVLRDYL 548  Streptomyce...
BAK34286        471 KLAVSRARATGSPAVFWLDETRAHDANLIAKINETLPEYDTDGLEIKILSPADAMAYSLERIRRGEDTISVTGNVLRDYL 550  Microlunatu...
jgi:Intca_0556  464 KLAVTRARATGNPAVFWLDEARAHDANLIAKVTEYLGEHDTDGLDIQILKPTEAIAFSLERIRRGEDTISVTGNVLRDYL 543  Intrasporan...
BAJ73651        469 KLAVTRARATGVPAVFWLDETRAHDRNLIAKVNEYLADHDTEGLTIEILAPAEATRYSLERIRRGEDTISVTGNVLRDYL 548  Microbacter...
WP_014847502    467 GLAVTRARATGWPAVFWLDETRAHDRNLLLKVKTYLAEHEIDDLDIRVLPPVEATRFTVERIRRGENTISVTGNVLRDYL 546  Pseudopropi...
6G3U_B          547 TDLFPIMELGTSAKMLSIVPLMAGGGMYETGAGGSAPKHVQQLVEENYLRWDSLGEFLALAVSLEETGIKTGNAKAKLLG 626  Pseudomonas...
Q7UX35          553 TDLFPILELGTSAKMLSIVPLLEGGGLFETGAGGSAPKHVEQIMSENHLRWDSLGEFLALAVSLEDLAEKTGNEEFAVLA 632  Pirellula sp.
WP_014436757    549 TDLFPILELGTSAKMLSIVPLLAGGGLYETGAGGSAPKHVQQFEKESHLRWDSLGEYLAVAVALGDSARKKGNTKRGVVA 628  Phycisphaer...
XP_002178894    623 TDLFPILELGTSAKMLSIVPLLAGGGLYETGAGGSAPKHVQQFVKEGHLRWDSLGEYLALAVALEGLADTAGNPKAKILG 702  Phaeodactyl...
XP_003063226    577 TDLFPIIELGTSAKMLSIVPLLRGGGLFETGAGGSAPKHVQQFTEENHLRWDSLGEYLALAVSLEDLAHKTRNPKIKTLA 656  Micromonas ...
CCB72125        549 TDLFPILELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLVKENYLRWDSLGEFFALVPSLEQYAKTTGNTRAQVLA 628  Streptomyce...
BAK34286        551 TDLFPIMELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLLKEDYLRWDSLGEFLALAVSLEHLAQSTGNKRAQVLA 630  Microlunatu...
jgi:Intca_0556  544 TDLFPILELGTSAKMLSVVPLINGGGLFETGAGGSAPKHVQQLVKENYLRWDSLGEFLALAVSLEHLAGATGNAKAQILA 623  Intrasporan...
BAJ73651        549 TDLFPILEVGTSAKMLSIVPLLAGGGLFETGAGGSAPKHVQQLVEEDYLRWDSLGEFFALAASLEHLADTTGNKRARVLA 628  Microbacter...
WP_014847502    547 TDLFPILELGTSAKMLSIVPLMAGGGLFETGAGGSAPKHVQQLLAENYLRWDSLGEFLALAASLEHLAS-TGNARAGVLA 625  Pseudopropi...
6G3U_B          627 KALDEATGKLLDNNKSPSRKVGDIDNRGSHFYLAMYWAQALAAQNEDAELKAHFAPLAKALTEQEATIVAELNAVQGKPA 706  Pseudomonas...
Q7UX35          633 KTLDDATGRFLDNDKSPSRKVGELDNRGSHFYLALYWAEALAGCAHEG-LKARFAPVAKALSENESTIVGELNDAQGVAV 711  Pirellula sp.
WP_014436757    629 RALDAATGKLLAEDRSPLRKAGQLDNRGSTAWLARYWAEALATQTEDAELAAVFGPVSDELGARMETILAEIDATEGQAA 708  Phycisphaer...
XP_002178894    703 DCLNKAVGRILTNRKSPSRVVNQIDNRATNFYVSLYWADFL--QQEDPSYKAIF----ESLTENRGKIVEEFSQCQGTAV 776  Phaeodactyl...
XP_003063226    657 KGLTTATGKLLDENKSPGRKVGEPDNRAAHFYVAMWWAEAVSRA------LPSFKQLASDLAASEDVIVRELTECQGSSV 730  Micromonas ...
CCB72125        629 DTLDRATATFLDEDKSPTRRIGGIDNRGSHFYLAMYWAQELARQTEDAQLAEAFADLARTLTEQESTIVDELNAVQGEPA 708  Streptomyce...
BAK34286        631 DTLDRATGTFLDENKSPARRVGSIDNRGSHFYLALYWAEELAAQTDDAELAAEFATLAAALREQEQTISDELIAVQGAPV 710  Microlunatu...
jgi:Intca_0556  624 DTLDRATGKVLDENRSPARRVGQIDNRGSHFWLAVYWAQELAAQTEDAELAGAFTDVAAQLTENADAIDAELIAVQGQPA 703  Intrasporan...
BAJ73651        629 QTLDAATGTFLENDKSPGRALGTIDNRGSHFYLALYWAQELAKQTTDADLAAVFGPVAEKLAAEEQTIVAELNAVQGHHA 708  Microbacter...
WP_014847502    626 STLDRANGRYLTENKSPTRRLGGTDNRGSHYWLARFWAEELAAQRENTGLAVAFAPVATALAEAEETITSELLAVQGSPV 705  Pseudopropi...
6G3U_B          707 EIGGYYRSNPELTSKVMRPSATFNAAID 734  Pseudomonas aeruginosa
Q7UX35          712 DLGGYYHPDETKANAAMRPSPTLNAIID 739  Pirellula sp.
WP_014436757    709 DLGGYHRPDRAKVDAAMRPSATFNAIID 736  Phycisphaera mikurensis
XP_002178894    777 DLGGYYLFDPAKTKAAMNPSPTLNKILS 804  Phaeodactylum tricornutum CCAP 1055/1
XP_003063226    731 DVGGYWLPDVDEAERAMRPSETFNALVD 758  Micromonas pusilla CCMP1545
CCB72125        709 DIGGYYKPDPAKAAAVMRPSETFNRAIA 736  Streptomyces cattleya NRRL 8057 = DSM 46488
BAK34286        711 DIGGYYRPDDDLTSAVMRPSATFNAAIA 738  Microlunatus phosphovorus NM-1
jgi:Intca_0556  704 DIGGYYKPDADKVDAVMRPSQTFNGIIA 731  Intrasporangium calvum DSM 43043
BAJ73651        709 EIGGYYRPNTELVEKVMRPSATLNAVVD 736  Microbacterium testaceum StLB037
WP_014847502    706 DIGGHYLPDETLASAVMRPSPTFNAIID 733  Pseudopropionibacterium propionicum
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap