Conserved Protein Domain Family
AFG1_ATPase

?
pfam03969: AFG1_ATPase 
AFG1-like ATPase
This P-loop motif-containing family of proteins includes AFG1, LACE1 and ZapE. ATPase family gene 1 (AFG1) is a 377 amino acid yeast protein with an ATPase motif typical of the family. LACE1, the mammalian homolog of AFG1, is a mitochondrial integral membrane protein that is essential for maintenance of fused mitochondrial reticulum and lamellar cristae morphology. It has also been demonstrated that LACE1 mediates degradation of nuclear-encoded complex IV subunits COX4 (cytochrome c oxidase 4), COX5A and COX6A, and is required for normal activity of complexes III and IV of the respiratory chain. ZapE is a cell division protein found in Gram-negative bacteria. The bacterial cell division process relies on the assembly, positioning, and constriction of FtsZ ring (the so-called Z-ring), a ring-like network that marks the future site of the septum of bacterial cell division. ZapE is a Z-ring associated protein required for cell division under low-oxygen conditions. It is an ATPase that appears at the constricting Z-ring late in cell division. It reduces the stability of FtsZ polymers in the presence of ATP in vitro.
Statistics
?
PSSM-Id: 397872
Aligned: 6 rows
Threshold Bit Score: 418.057
Threshold Setting Gi: 444896207
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
P64612     4 VTPTSQY-LKALNEGSHQPDDVQKEAVSRLEIIYQ---ELINSTPPAPRtsglmARVGKLWGKREdtKHTPVRGLYMWGG 79  Escherichia coli K-12
CCP45468  33 TVSPVRL-IAQLRPPPTFAEVSFATYRPDPVEPTQaaaVVACQDFCRQAve--rRAGRKKWFGKR--DVLPGVGLYLDGG 107 Mycobacterium tuber...
Q9KUF3     1 MTPKQRY-EKDLQRTDFYSDEAQARAVDALDNLYHqwlNYLNQPVVRP------SVWQKLIGKKPt-VTQPPQGLYMWGG 72  Vibrio cholerae
Q9HVX7     1 MTPLERY-QADLQRPDFFHDAAQANAVKHLQRLYD---DLVAADHAKP------GLFGKLLGRK---SGGPVKGLYFWGG 67  Pseudomonas aeruginosa
Q9HVN8    18 TTPVARYfHQEAQRRGYVLDAAQGNAILHLDRLAE---RLRRGPS--------------LFR-------QAPRSLYLWGP 73  Pseudomonas aeruginosa
Q9A2M6     3 TSLRTAY-RERLAQGEIRPDVAQAAAVEALSRLEA---DLDAAGEPGFS----------FFGRKPk-SQ---RGVYLWGP 64  Caulobacter vibrioides
P64612    80 VGRGKTWLMDLFYQSLPGeRKQRLHFHRFMLRVHEELTALQg--------------QTDPLEIIADRFKAETdVLCFDEF 145 Escherichia coli K-12
CCP45468 108 FGVGKTHLLASAYYQLPG-TGPDAPTCPKAFATFGELTQLA---------------GVFGFADCIDLLANYT-ALCIDEF 170 Mycobacterium tuber...
Q9KUF3    73 VGRGKTYLMDTFFEALPTeKKLRVHFHRFMYRVHDELRTLSd--------------VSDPLEIVADRFCAEAnIICFDEF 138 Vibrio cholerae
Q9HVX7    68 VGRGKTYLVDTFFESLPFeQKVRTHFHRFMKRVHEELKTLKg--------------EKNPLTIIGKRFADEArVICFDEF 133 Pseudomonas aeruginosa
Q9HVN8    74 VGRGKSWLMDGFFRSADLqGLRRTHFHAFFRRLHDGMFRRQg--------------RPDALGGALDELLGDCrLLCFDEF 139 Pseudomonas aeruginosa
Q9A2M6    65 VGRGKSMVMDLFFDSAPVaKKRRIHFHAFMAEVHADIDVWRkgdaatrkarfgqskGDDPVAPTADRIAGEArLLCFDEL 144 Caulobacter vibrioides
P64612   146 FVSDITDAMLLGGLMKALFARGITLVATSNIPPDELYRNGLQRARFLPAIDAIKQHCDVMNVDAGvDYRLRTLTQAHlwl 225 Escherichia coli K-12
CCP45468 171 ELDDPGNTTLISRLLSALVERGVSVAATSNTLPEQLGEGRFAAQDFLREINTLASIFTTVRIEGP-DYRHRDLPPAP--- 246 Mycobacterium tuber...
Q9KUF3   139 FVSDITDAMILGTLFEALFRRGIVLVATSNIAPKDLYRNGLQRARFLPAIALVETHCQILNVDSGvDYRLRTLQQAEiyh 218 Vibrio cholerae
Q9HVX7   134 FVSDITDAMILATLLEELFKNGVSLVATSNIVPDGLYKDGLQRARFLPAIALLKEHTEIVNVDSGvDYRLRALEQAElfh 213 Pseudomonas aeruginosa
Q9HVN8   140 HVHDIGDAMLITRLFRELFGRKITLVCTSNYAPRQLLPNPLYHERFLPAIRLIETRMEVLEVAGArDYRTISPRQEIasg 219 Pseudomonas aeruginosa
Q9A2M6   145 QVTDIADAMILGRLFEALFARGVTLVATSNRPPEDLYKDGLNRQLFLPFIDMLKSALDVVAVRGPvDFRLDRLRAARtwl 224 Caulobacter vibrioides
P64612   226 splhdetraq--mdklwlalaggkrENSPTLEINHRPLAtmGVENQTLAVSFTTLCVDARSQHDYIALSRLFHTVMLFDV 303 Escherichia coli K-12
CCP45468 247 -------------------------APLSDEEVAARAAR--VEGATLDDFDALCAHLATMHPSRYLTLIEGVTAVFLTGV 299 Mycobacterium tuber...
Q9KUF3   219 ypldskatdn--lqryfqqlisseqTPETQIDVNHRMITveAAGDGVLYATFAQLCQTARSQNDYIELSKIYHTVLLADV 296 Vibrio cholerae
Q9HVX7   214 wplseqveeemarsfkaltpdcakaQRDEALMIENREIRarLTCDDVAWFEFRELCDGPRSQNDYIELAKIFHAVLISNV 293 Pseudomonas aeruginosa
Q9HVN8   220 yasggycwpascacldelglsapepSQRVTLQSGARTLQarAVCGDLVWFAFADLCEAPTAVMDYLALGERFSTWVLEGV 299 Pseudomonas aeruginosa
Q9A2M6   225 apndkasqaa--fdglwtdmldgapETGATLEVLGRKMRlpRAAGGLVRSSFASLCQQALGPQDYLAIAERFHTLFLEDV 302 Caulobacter vibrioides
P64612   304 PVMTrlMESEARRFIALVDEFYERHVKLVVS---AEVPLYEIYQGDRLKFEFQRCLSRLQEMQSEEYLKRE 371 Escherichia coli K-12
CCP45468 300 HGID--DQNVALRLVALVDRLYDAGIPVVASgakLDTIFSEEMLAGGYRKKYLRATSRLLALTAGVIQARE 368 Mycobacterium tuberculosis H...
Q9KUF3   297 KQMNksSDDAARRFIALVDEFYERHVKLIIS---AEVPLTDLYTDGLLEFEFKRCQSRLIEMQSHDYLAKE 364 Vibrio cholerae
Q9HVX7   294 EQMGvtKDDMARRFINLVDEFYDRSVKLIIS---AEVELKDLYSGGRLEFEFQRTLSRLLEMQSHEYLTRP 361 Pseudomonas aeruginosa
Q9HVN8   300 PPMArcSVAAQQRFINLVDVLYDNDRRFFLS---AEKALPDLVEGSDLPADMQRTASRLAQLRQ---LRC- 363 Pseudomonas aeruginosa
Q9A2M6   303 PCLTpaRRDAARRFNTLVDALYEADVKLVAL---AEAEPEQLYPEGEGAFEFERTVSRLQEMRSADYVGRV 370 Caulobacter vibrioides
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap