1OKR,1XSD,2G9W


Conserved Protein Domain Family
Penicillinase_R

?
pfam03965: Penicillinase_R 
Penicillinase repressor
The penicillinase repressor negatively regulates expression of the penicillinase gene. The N-terminal region of this protein is involved in operator recognition, while the C-terminal is responsible for dimerization of the protein.
Statistics
?
PSSM-Id: 397868
Aligned: 47 rows
Threshold Bit Score: 89.1889
Threshold Setting Gi: 81345468
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1OKR_A   8 ISSAEWEVMNIIWMKKY-ASANNIIEE-IQMQ-KDWSPKTIRTLITRLYKKGFIDRKKD-NKIFQYYSLVEESDIKYKTS 83 
Q8NUB9  10 LGPLEEQVMHILWDHGK-LTVREVIEF-LPGDp---AYTTIATVLRHLGRKGMVTTVKD-GRTARHSALMNREQYTAGIM 83  Corynebacterium gluta...
Q8FSR7  10 LGPLEEQVMGILWDHGE-LTVREVIGY-LPADp---AYTTIATVLRHLGRKGMVTVVKD-GRSARHAVRMSREEYTAGVM 83  Corynebacterium effic...
Q8YTZ4  14 VGPLEAEILNIVWEVGS-ATVKDVHDRiLADPnRELAYTSVTTVLRRLTDKGWLACDKK-GRAFYWRPLLSKQQAQVIKA 91  Nostoc sp. PCC 7120
P72695  14 LGPLEQEILQIIWQLGQ-ATVKDIHDRiLSDPdRELAYSSVTTVLNRLTKKGWLVCHRQ-GKAFIWTARVSADQAKAVQS 91  Synechocystis sp. PCC...
Q81S93  17 FGPLEAKIMEIVWSSEG-ITIKEVQQK-LSEE-SPVNFNTVMTVMNRLVEKLHLEKQTV-KRSGIYRAVQTKDEFLSNQT 92  Bacillus anthracis
Q7NDR0  51 LGDLEAEIMEAVWAQGQpVLAKDIHPQ-LPSG-KDLSYSTIVCTMTALVEKHLLQVVAKeGKARIYLPTTSREDFLHQTL 128 Gloeobacter violaceus
Q7UFN9   9 LGKRQRQIYETVHRLGN-ASVTSVRDG-LEDPp---SYSTVRAILNRLVDQGWLLSEQD-GPRLVYRCTQKQVAAKRSMA 82  Pirellula sp.
Q7UP31  14 LGARERQILDAVYHLGQ-ASVADVRSQ-LNDPp---SYSSVRTMMGILETKGFLRRHRD-GVRHLYSATRSREKAGRSAL 87  Pirellula sp.
Q7NMJ8  14 LGPLEAEIMEIVWKRGA-LAVKDVHDElLSDPdRELAYASVTTVLRRLVQKGWLSCDTS-QRAFCFTPRISREQARTLTA 91  Gloeobacter violaceus
1OKR_A  84 KNFINKVYKGGFNSLVLNFVEKE--DLSQDEIEELRNILNK 122
Q8NUB9  84 DQVLSTSR--DRSASILHFVDT----ITATDRELLLEYLQQ 118 Corynebacterium glutamicum
Q8FSR7  84 GQVLEASH--NRTASILHFVDS----MGESDRALLLDYLQR 118 Corynebacterium efficiens
Q8YTZ4  92 HDQLHSFLAVGNPDVVAAFADSLd-EAASEQIEAIAKRIQA 131 Nostoc sp. PCC 7120
P72695  92 YEQLQQFLAISNPDVVAAFADSLd-TASIDQLTAIADRLRA 131 Synechocystis sp. PCC 6803
Q81S93  93 KKMTQELMG-EFGDLVVNHMLDEleQADPNLIKKLEDKLSQ 132 Bacillus anthracis
Q7NDR0 129 GHVIDNILA-AFPDTAAALMQRRl-DTDEASLPRLRQQLDA 167 Gloeobacter violaceus
Q7UFN9  83 KQVLQNFFQGSPAEALAAFLDASerPLTEDEVDQMIEEVQR 123 Pirellula sp.
Q7UP31  88 THLMSTFFEGSASKMIAALLDESasQLSEDELAELQQSIDQ 128 Pirellula sp.
Q7NMJ8  92 HSRLQAFLSVGTPEVVAAFADSLd-EASVEQLGAIAERIRQ 131 Gloeobacter violaceus
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap