Conserved Protein Domain Family
FlgD

?
pfam03963: FlgD 
Flagellar hook capping protein - N-terminal region
FlgD is known to be absolutely required for hook assembly, yet it has not been detected in the mature flagellum. It appears to act as a hook-capping protein to enable assembly of hook protein subunits. FlgD regulates the assembly of the hook cap structure to prevent leakage of hook monomers into the medium and hook monomer polymerization and also plays a role in determination of the correct hook length, with the help of the FliK protein. This family represents the N-terminal conserved region of FlgD. A recent crystal structure showed that this region was likely to be flexible and was cleaved off during crystallisation.
Statistics
?
PSSM-Id: 397867
Aligned: 49 rows
Threshold Bit Score: 47.6208
Threshold Setting Gi: 81563617
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q24T88                 9 YNDYSkySSTSESKQSSAVSDATKEVLGKDDFLKLLVAELTNQDPLSPMDNKDMITQMAQFSSLEQMNNMSKSMEN 84  Desulfitoba...
CDE35458              14 SSTTE--STTISSKSTKEKDAKESSTLDVNDFLSLLVTEMQYQDPLEPTDNSQYIAQMATFSQVEATKEM---LDT 84  Eubacterium...
CCZ78387              11 WASVE--NGKVKTTTSKKSDESNNGTMGYDQFLTLLCAEMQYQDPLEPTSNTEYVAQLATFSQLEAMLGMQDTQkn 84  Roseburia s...
goetting:PGA1_c35910   8 ASASQ--QQQAASTASAEPKKTTGIASDFETFLKMLTAQARYQDPLEPIDSTEYSAQLAQFSMVEQQVQGNEVLEg 81  Phaeobacter...
WP_014248075          26 tATET--SKTPQTDADKTASATKGLGDNFQTFLTMLTTQMKNQDPLKPLDTNDMTKQLVDFANVEQNIGTNSRLDK 99  Azospirillu...
Q6NA81                10 TPYSApnPNYSADSAKSKTSSTPGIADNFQTFLTLLTTQLKNQNPTDPLDTNQFTQQLVQFAGIEQQLKTNDSLSS 85  Rhodopseudo...
WP_009735276          15 APATT--SNSSSNSSSGSSTSGATLADNFQSFLMLLTTQLQNQNPLDPLDTNQFTQQLVQFAQVEQQLKSNSQLES 88  Bradyrhizob...
Q7NXC4                10 QFSAS--NQQGGEQKVAPAAGKNGAQPGNDMFMTLLLAQIRNQSPLDPADPSQFVSQLAQMSQMQSTQDMLKQLQS 83  Chromobacte...
jgi:Terro_1833        12 QQTAR--VSAYASSASSNSSADDATTITSSDFLTLLVTQMKNQDPTEPTDPSQYLQQLVGVNSLEQLIDVNKQLTS 85  Terriglobus...
Q81FE2                25 ASVNGvqSPVQQTNGVSASNQKTPGIMDKDDFLKLFLASFQHQDPFNAMDMNQMMNQTAQLSLMEQVQNMTKAVDK 100 Bacillus ce...
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap