Conserved Protein Domain Family
Lys_export

?
pfam03956: Lys_export 
Lysine exporter LysO
Members of this family contain a conserved core of four predicted transmembrane segments. Some members have an additional pair of N-terminal transmembrane helices. This family includes lysine exporter LysO (YbjE) from E. coli.
Statistics
?
PSSM-Id: 397860
Aligned: 176 rows
Threshold Bit Score: 105.963
Threshold Setting Gi: 74577644
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
CDC99986         8 LCCFLLGIAVGLSglSPE-------WLLDAAL---PSLLLSLLILQVGVGLGANDDLRGIVRSLRLRMLLLPLFTIAGSL 77  Alistipes sp....
CDA92644       144 fGSVIVGMALGYFaaRPIfgs--eiAQFDHAAslgIKTGLCILMVFVGLDLGLQGTVFQMMRDAGLRILIFPFVTIVGTF 221 Firmicutes ba...
jgi:Shel_21000 131 vcsvaaGVAIGWAcsTFAhvpfetlNGYAGVA---IRVGLCVLLVLIGLDLGLEGTVIRNIRNAGLRVLAVPFVTVAATL 207 Slackia helio...
CDB02123       147 LISVIIGMLTGYFviREMfvg--nmEAFESAAglgIKLGLCLLLIFVGIDLGIEGSVISNFKAVGLRIFAIPAAVVAGTL 224 Firmicutes ba...
CDA92454       142 tidvvIAMLIGYFviRSAfad--dyEVFDNVTskaIVVGLSLMIGLVGFSLGLDGTVIAKLKETGIKVLIVPILFILGTT 219 Firmicutes ba...
CDB02122       125 LTFVVAGMAAGYFmiPEIfedtdafQDMSGDW---LVVGICILLALAGFNLGLEGKVIQSFKGVGIKVIFIPIAAVAGSL 201 Firmicutes ba...
CCZ46910       125 FAMVAAGMLLGYFvvPRVtdp-dafQTMSGSW---LVVGLCLLLAFVGFGMGLEGKLKAMLRGAGLGIILVPLAMVAGSL 200 Firmicutes ba...
WP_013450192     6 ILAVISGAILSQFnlLPHf-----fLTYSSDI---TDYALYLLLFIVGFDIGRDTEALKRLFTADRYAFLIPIGTIMGTL 77  Calditerrivib...
WP_013886388     6 LAAVTAGTLTAQFsiLPEf-----iIIGTDEI---TRYMLYLLLLLIGYDIGRDKNTIRKLINADRQAFFIPFGTIAGTL 77  Flexistipes s...
BAI80756         6 IIAVICGVLFAQFgfLPTf-----lTEYSGNI---TDYSLYLLLLLIGYDIGRDKESIMKLVSADRYAFLVPFGTIVGTL 77  Deferribacter...
CDC99986        78 LFSAAAALLPgNRPLAECLAVGSGFGYYSLSSVLIADvGaaslgeggAAELATVALLANVVREMFALFCLSLFARWCGRV 157 Alistipes sp....
CDA92644       222 IGAAIAGPLM-GFSLREAMAVGAGFGWYSLAPGIIMDaG--------LIEASAVSFLHNVLREIISILFLPFVAEKIGYI 292 Firmicutes ba...
jgi:Shel_21000 208 AALAVCSIFL-PLSLRECLAIGAGFGWYSLAPGIIMDqG--------YITAGAVSFMHNILRELLSIITIPLVARHVGYI 278 Slackia helio...
CDB02123       225 TAAFVMSFFL-DLTMRESLAIGAGFGWYTLAPGIIMEaG--------HMTASAVCFLHNVMRELFAIVLIPFVAKKIGYV 295 Firmicutes ba...
CDA92454       220 FAGVIFSLIT-EFSMKEALAICWGFGWYTYAPGVIAEaG--------YVIASAVSFLHNVIRETVGIIGIPLIAQKIGYL 290 Firmicutes ba...
CDB02122       202 IMGAVYGLIS-SLTVSESIAVSAGFGWYTLAPGMLTEaG--------FAVAGAVSFMHNVIRETLGIVLIPIAAKKIGYL 272 Firmicutes ba...
CCZ46910       201 LAGVIYSLLS-PMTLREGLAISAGFGWYTLAPSVISGaG--------HAVAGAVSFLHNVLRETLGIIFLPLAASKIGCI 271 Firmicutes ba...
WP_013450192    78 FGGFIASFLI-TISIKHSMAIASGFGWYSLSAVIISKsA--------GSDLGSIAFLSNVFRESMSIITIPIISKYLGPF 148 Calditerrivib...
WP_013886388    78 AGGAFAVLFI-NMSIKDSLAVSAGFGWYSLSAVIIADaK--------GSDLGSVAFLTNVFREIISIILIPVLAKYVNPY 148 Flexistipes s...
BAI80756        78 VGGFVASFFL-AISVKDSLAIAAGFGWYSLSAVIIAKmK--------SADLGSIAFLSNVSREIISIMLVPYLAKYVDPY 148 Deferribacter...
CDC99986       158 APISAAGINSMDVCLPGIVRYSggSTQLVPLAVLHGIALEVSVPLLIGFFC 208 Alistipes sp. CAG:268
CDA92644       293 EAACMGGSPAMDVCLPVINKET--KGKAVTYGFITGVIMSFLVPFSVPLAL 341 Firmicutes bacterium CAG:238
jgi:Shel_21000 279 ESTGLAGAAAMDVCLPVVEQST--NGITTVYAFVSGVVLSVLVPVLVPLFi 327 Slackia heliotrinireducens DSM 20476
CDB02123       296 ETVGLPGSAAMDVCLPIVEKAT--RSDIAVYSFISGAILSILVPILVPVII 344 Firmicutes bacterium CAG:145
CDA92454       291 EATTLPGIASMDVCMPIIERSC--RQDTIVYGFCNGLLSSLVCSFMVPIII 339 Firmicutes bacterium CAG:238
CDB02122       273 ECTSIPGVAAMDVCLSIVERSC--RAETVVYSFCTGALMCVCVPVVVTLAi 321 Firmicutes bacterium CAG:145
CCZ46910       272 EAVTLPGTCAMDVCLPIVERSC--SAETLPYSFTTGMAACLFSALLVPLIM 320 Firmicutes bacterium CAG:129
WP_013450192   149 IAIPPAGATSMDTTLPIIQKYA--GDEAAVVAFVHGFILSALVPIFVSFFL 197 Calditerrivibrio nitroreducens
WP_013886388   149 VSIAPGGATTMDTTLPIIEKYA--GSSAAFIAFLHGFILSSLVPVIVPVFl 197 Flexistipes sinusarabici
BAI80756       149 VSIAPGGATTMDTTLPIIEKYA--GSSAAIVAFINGFILSALVPILVPFIL 197 Deferribacter desulfuricans SSM1
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap