Conserved Protein Domain Family
SKN1

?
pfam03935: SKN1 
Beta-glucan synthesis-associated protein (SKN1)
This family consists of the beta-glucan synthesis-associated proteins KRE6 and SKN1. Beta1,6-Glucan is a key component of the yeast cell wall, interconnecting cell wall proteins, beta1,3-glucan, and chitin. It has been postulated that the synthesis of beta1,6-glucan begins in the endoplasmic reticulum with the formation of protein-bound primer structures and that these primer structures are extended in the Golgi complex by two putative glucosyltransferases that are functionally redundant, Kre6 and Skn1. This is followed by maturation steps at the cell surface and by coupling to other cell wall macromolecules.
Statistics
?
PSSM-Id: 397841
Aligned: 24 rows
Threshold Bit Score: 674.001
Threshold Setting Gi: 758984553
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_011386883        384 WGDYDAESEPDDYLHEPDAekYRNASSAK-----EMLSPRGLLNIGTLTVIGLGLILLFGGYPVISWL----SRSKASTk 454 Ustilago...
O13789              134 FSLSREDKEIDDFLHYPLPakDAKkl-------sYFVGGEGLMQLLFLLFLAAGTGMLFIGLPILTYTg---HNSLAS-- 201 Schizosa...
XP_001589156        211 FILYDDEIEDDDDLHMP----HDNDDRDFkptwyEWLERRSLINAIGGVFMVIGLLCVFILLPVLTFAtrvwSTGREGSg 286 Scleroti...
Q0UKL9              161 LLLFPEDVEKDDYLHNPDP-------NEKeqrdcDIFTRRGMVNVGGLAFLALGLLALFVGYPVLTFVdkmtKPEKGPCt 233 Parastag...
EAW14048            154 LLLFPEDVEKDDHLHNPDP--------SDregqcDLWNRRGIINVAGLILLTLGFLILFIGYPMITAMkg-tVKSGPTCd 224 Aspergil...
XP_001598834        168 LLLFPEDVEKDDYLHNPDP-------SDKdldkcDIWNRRGLTNVGGLIFIVLGVLALFVAYPVVTFVkdkiDPTHGAC- 239 Scleroti...
WGS:AFWA:PNEG_02704 189 ilwdpNIAEPDDYLHNP--------ATKEkrkdyCIFTKRGILNIGSLVILIFGIISFFIGYPILLYAr---KIYEDIH- 256 Pneumocy...
Q5KJ60               92 QGPIDDDDDMDDHLHTF-----TAAEKKDlstpfNISSWRGWANALTLAVLAGGGVMLFAGYPIISFYyg-dDSSSGSNt 165 Cryptoco...
Q5KHK4               69 WGPMTTGPEEDDWMHNPDPikNRNYDRGT------IFTPRGLINVGCLVMLILCLVTLFAGYPIITHF----TDTEIKTn 138 Cryptoco...
KIS68483            197 WDTMDGKQEPDDDLHDP-----QVLPDIKhgwfgGAVGSRGVLNVGVLALLSMALVLLFGGYPIISYF----GRRHESTk 267 Ustilago...
XP_011386883        455 g----gfNLGGANATGQVADLKIGR--GLIDPDTPESVKTRTTLnGsGKKMNLVFSDEFNRDGRSFYPGDDPFWTAVDLH 528 Ustilago...
O13789              202 -------TRVTGITNHQFRILRLLRygSLIDPDTPESAYTFDSQ-D-LGTLDLVFSDEFNYPGRAFYDGDDQFWLATDLH 272 Schizosa...
XP_001589156        287 sgyvdygPAWAHVNNNTYPLLKNVRt-TLIDPDTPQTARTRESTfN-GETLNLVFSDEFNNNNRTFYPGDDPFWTAPNIW 364 Scleroti...
Q0UKL9              234 ------gNPLCIQGKQNEPILSTYEr-G--S-STPT---------------QLGFSDEFNVDGPLFYDGDDPYFQAVDIW 288 Parastag...
EAW14048            225 ------pRDTLCLDVGDRPLLSNIRr-GLIDPDTPKSARSKKSA-D-GKEWKLVFSDEFNTDGRTFYDGDDPFYQAVDIW 295 Aspergil...
XP_001598834        240 -------AAAIDCLSIKIPLLKNVRt-GLIDPDTPDSVKSKTAQ-D-GTKLKLVFSDEFNTDGRTFYDGDDPFFQAVDIW 309 Scleroti...
WGS:AFWA:PNEG_02704 257 -------RCPDCIKTLPIDLLGATR--GLIDPDTPEEFYELKNS-D-GKVYKLVFSDEFNKDGRTFYPGDDQFWEAVDLH 325 Pneumocy...
Q5KJ60              166 s----gyNLGGINASGQYPSITGLP--SLIDSDTPEYLYTRTGF-D-GKEWTLVFSDEFEKDGRTFFEGDDPFWTGVDLN 237 Cryptoco...
Q5KHK4              139 g----ayNIGGINSTGQVPLISNIP--TVIDSDTPVDKYTRTGF-D-GKTYSLVFSDEFEKEGRTFFPGDDPFWTGVDIH 210 Cryptoco...
KIS68483            268 g----gyNLGGVNASGQIASIPGLRs-SLIDPDTPQDARTRLSP-DgTKTMKLVFSDEFNTPGRSFYPGDDPFWEASDLH 341 Ustilago...
XP_011386883        529 YWGTENYEWYDPSAVTTANGSLVITLDEVPTHNLNFRGGMLQSWNQFCFT-GGYIEVSMVLPGAPDVAGLWPAAWTMGNL 607 Ustilago...
O13789              273 YAATTDYEYYDADTPTTANGTLRLRMDAFYNHDLNFRSGMVTTWNKLCFK-GGRIEVSASLGGSPYIPGFWPGIWTIGNL 351 Schizosa...
XP_001589156        365 YGATQDMEWYDPVAVTTGGGTLQLRMDAFPNHNLGYQSGMLNSWNQLCFK-GGIFEVSVSLPGPSGVPGLWPGVWSMGNL 443 Scleroti...
Q0UKL9              289 YGATQDLEWYDPDAAWTQNGTLVFEFARHDNHGLKYRSGMVQSWNKLCYK-GGHLEASISLPGKGNVSGFWPGFWTMGNL 367 Parastag...
EAW14048            296 YGVTQDLEWYDPDAVTTRDGVLEIRFDSFPNHELKYRSGMVQSWNKLCFT-GGRLEASISLPGSGDVSGFWPGFWAMGNL 374 Aspergil...
XP_001598834        310 YGATQDLEWYDPDAVTTGNGTLNIKFDAFQSHNLNYRSGMIQSWNKLCFK-GGRIEASISLPGRGDWPGFWPGFWSMGNL 388 Scleroti...
WGS:AFWA:PNEG_02704 326 YWSTLSLEWYDPDAITTNGGFLEIRLDAFRNHDLNYRSGMLQSWNKLCLK-GGIIEASISLPGRGDTSGLWPAFWMMGNL 404 Pneumocy...
Q5KJ60              238 YWPTGDLEWYDPSAITTADGHLVITVTQEPIHDLNFKSGMLQSWNKFCVSkNAYIEFSASLPGTSGIGGFWPGVWTMGNL 317 Cryptoco...
Q5KHK4              211 YWPTGDFEWYDPAAITTKDGHLVITLDQQNIHDLNFRSGMLQSWNQICFQySIYIETSVSLPGNNRVGGFWPGIWMMGNL 290 Cryptoco...
KIS68483            342 YWATNNYEWYSPEAVTTRDGALRITLDQVQTNNLNFRGGFLSSWNKFCFT-GGYLVASVQLPGAARVAGLWPAFWTMGNL 420 Ustilago...
XP_011386883        608 GRAGYGASTDGMWPYTY-DSCDVGTLPNQTYVNGtgpiaaqttg--vyvekygpyLSYLPGQRLSRCTCnSSNDHPGPrh 684 Ustilago...
O13789              352 VRPGYLATSDGVWPYSY-NSCDAGITPNQSDPSG---------------------ISYLGGQRLNQCVC-KGEDHPNV-- 406 Schizosa...
XP_001589156        444 GRPGYKATTEGVWPYTY-NTCDYGITPNQSSSDG---------------------LSKLPGQKLNSCTC-KGQDHPTP-- 498 Scleroti...
Q0UKL9              368 ARPGYLGSTEGLWPYSYdDVCDLGITANQSSYDG---------------------LSYLPGMKLPACSC-SGEDHPSP-- 423 Parastag...
EAW14048            375 ARPGYAATTEGMWPYSYhDKCDAGITPNQSSTDG---------------------ISYLPGMRLPACTC-AGEEHPSP-- 430 Aspergil...
XP_001598834        389 GRAGYQATTEGMWPYSYwDKCDYGITANQSSSDG---------------------ISWLPGMKLPACTC-KGENHPSS-- 444 Scleroti...
WGS:AFWA:PNEG_02704 405 GRPGFGASTEGTWPYSY-DNCDIGITPNQSDHSG---------------------FSFLPGMKLPGCTC-PNSDHPSP-- 459 Pneumocy...
Q5KJ60              318 GRPGYGASTEGMWPYTY-NSCDVGILPNQTWLNGtgpeaalt------sgssgtqLSLLPGMRTPSCTC-EGEDHPGPd- 388 Cryptoco...
Q5KHK4              291 GRPGYGATTDGTWPYSY-DSCDYGTLANQTNPEGtgpegalt------sgsddsaISYLPGQRMSSCTC-QGEDHAGPd- 361 Cryptoco...
KIS68483            421 GRAGYGATTDGTWPYSY-TACDVGTLMNQTDANGqpaaaaiggdvmwnrkaestsLSFLPGQRLSACTC-AGDDHPGPll 498 Ustilago...
XP_011386883        685 adgTwVGRSAPEIDIIEAAASHTRGs--------RGHASMSAQIAPFNTGYNLTDg--PGTTEFFSDDAALNSYTGSPLQ 754 Ustilago...
O13789              407 ---G-TGRGGPEIDALEGTFGSGIPyngsiyletMPVVSQSAQYAPFDLYMYPNY---DFVTIYNQSVSAMNGWAGGVYQ 479 Schizosa...
XP_001589156        499 ---G-TGRGAPEIDVLEGSVDPNNR---------IGVVTQSFQVAPFDIWYRPNY---VFLQIPEYNTTSMNSYCGGPFQ 562 Scleroti...
Q0UKL9              424 ---G-TSRSAPEIDAVEGSVHFLGPget----naVGVVSQSFQAAPFDIWYQPDY---DYVEVYDTSVTMMNAYKGGPFQ 492 Parastag...
EAW14048            431 ---G-RSRSAPEIDVIEASVIPLNDngn----avIGSVSQSLQMAPFDIWYMPDY---EFTAVYDPYVTQINSYRGGPYQ 499 Aspergil...
XP_001598834        445 ---G-SSRSAPEIDAIEASIGFLKEnwg----agTGAASQSYQIAPFDIFYMPDY---NYVELYDNEQSSINSYRGGNYQ 513 Scleroti...
WGS:AFWA:PNEG_02704 460 ---G-KGRGAPEIDIIEASVDLSLH---------IGEASQSVQFAPFDDNHRPNY---DHMAIHNTEKTHINPYRGNVFQ 523 Pneumocy...
Q5KJ60              389 --vT-VGRSSPEIDIIEAQIIISEN---------RGEVSQSFQTAPFDDYYQWDNtstSNYKQYDTDLTYWNTYLGGTYQ 456 Cryptoco...
Q5KHK4              362 --vT-YGRGVPEIDILEGQLDLSVD---------KGQVSQSAQFAPFDYGYQYLNt-sKGAIQYDTDITMWNSYKGGTYQ 428 Cryptoco...
KIS68483            499 kdgTyRGRSAPEIDVFEAQVDGTLG----------MTVSQSMQTAPFNMYYNITNt-tGPAYEFFQPDSHLNLYTGQNDQ 567 Ustilago...
XP_011386883        755 QAASGLVYTKRGAYQeTL---GQFSSYGYEYNp--GSDPDSYILWTLDGAPMWQLNSKALGPDAgtQISQRPIPYEPMYI 829 Ustilago...
O13789              480 QALSCASQLNNSWLs-----gNAYQKYGFDYKp--GSGPDALISWFVGDEYTWTMRQPAVGQNG--NIASRPVSEEPMIV 550 Schizosa...
XP_001589156        563 QAISGTTLLNNNWYd-----gNAYQKYAFEYIp--GTSSTGKIAWFVGDQQTFMMDGRAIGQNG--NVAARQVSQEPMSM 633 Scleroti...
Q0UKL9              493 EAISGLTNLNNDWYd-----gNQYQTYGFEYKp--GKKDDAFITWYVGADKTWSMKAPGTRPNG--NIGQRIIPEEPMTI 563 Parastag...
EAW14048            500 QAMSGLSNLNNKWYn-----gTEYQVYAFEYTp--G--AHGEVTWFVGPERTWTLDGRAIGPNG--NIGQRVIPLEPMSI 568 Aspergil...
XP_001598834        514 QAMSSLTWLNNDWYd-----gNGYQTYGFEYTp--G--ATGKITWFVGDQYTWKMDGRALRPNG--NIGQRTIPEEPMTV 582 Scleroti...
WGS:AFWA:PNEG_02704 524 QTFSCITYLNNEWYn-----gYKFQTYGLEYKp--G--KKGYIEWFIGDQATWKMKSESVGPNG--NIGQRLISEEPMAI 592 Pneumocy...
Q5KJ60              457 QSVSSLTRVPRDIYYsQSgggGEFAMFAMEYDsapNNKEDGYVTWYSDNKTSWTMYADAVAANErvGIGRRTIPEEPMTL 536 Cryptoco...
Q5KHK4              429 EAVSSLTYIDSDNYMgTSg---gFGIYAFEMFsdpNDRDSGYITWVANGEKSWTMYPAAVGPLSsmNIGQRLISEEPMAM 505 Cryptoco...
KIS68483            568 QALSGITVASQLAV--QRggdGSYATYGFEYEpg----pQGYIDWVSNGQRAWKVHSAALAADPvsQISDRPIPEEPMYI 641 Ustilago...
XP_011386883        830 LLNLGISSSFTTVDWRHLN--WPAKMLVDYVRVWQVEGEEN----IGCDPENAPTAAYIEAHKEVYYNANLTTWtepkEK 903 Ustilago...
O13789              551 VLNFGISPTWIYFYWYELT--FPQTMYVDYVRIYQDSSDSSs--vLGCDPEGFPTTEYIANHPKAYLNYNATSW----SE 622 Schizosa...
XP_001589156        634 VLNLGMSGSWSEILMGELR--FPTTMHVDYVRIYQREGQES----VTCDPEGYETTEYIREHPVAYMNPNLTAW----NE 703 Scleroti...
Q0UKL9              564 IANSGMSNSFAAIDVPTIEknLPSLMAIDFIRIYQDEDQENdddfMTCDPPGYPTTEYIRKHPNAYMNPNLTDW----KS 639 Parastag...
EAW14048            569 IMNLGMAYSFAGINDT-IQnyMPGIMRFDYIRIYQDPDNIS----VTCDPPGYETTEYIAKHPKAYQNINKTTW----TD 639 Aspergil...
XP_001598834        583 IMNLGMGTSFSEVMMPNLNtlFPATMRFDYLRIYQPEGSES----VTCDPEGYPTTEYIAQFPKAYDNQNHTSW----SD 654 Scleroti...
WGS:AFWA:PNEG_02704 593 IINLALSESFSKIEWGKLQ--FPAIMRIDWVRIYQEES--L----ITCDPPGYPTTKYIKDHPIAYYNNNVTTW----NN 660 Pneumocy...
Q5KJ60              537 IVNLGLSFNFQPVDFDHLT--FPNYLRIDYFRVYQQSDSIS----IGCDPDDYPTADYISKHAEVYSNANLTTW----AQ 606 Cryptoco...
Q5KHK4              506 VINFGMSNNFQAIDFSNLI--FPSEMHVDYVRVYQRSEG-R----MGCDPDDRPTAAYIEKHANAYNNPNFTTW----DM 574 Cryptoco...
KIS68483            642 IFNLGISENFGFPDWRHLR--WPAVMSVDWVRVYQDPDAEN----VGCDPPDFPTADYIERHRAAYYNANYTVWggspDQ 715 Ustilago...
XP_011386883        904 GGYgaKFPGNSMLgQ-C 919 Ustilago maydis 521
O13789              623 AGY--VRPKNSLMdG-C 636 Schizosaccharomyces pombe 972h-
XP_001589156        704 TGY--DWPTNKLMnN-C 717 Sclerotinia sclerotiorum 1980 UF-70
Q0UKL9              640 TGF--DWPKNTFVdG-C 653 Parastagonospora nodorum SN15
EAW14048            640 AGY--EWPSNSFMhG-C 653 Aspergillus clavatus NRRL 1
XP_001598834        655 AGY--SWPKNSFVdT-C 668 Sclerotinia sclerotiorum 1980 UF-70
WGS:AFWA:PNEG_02704 661 TGY--EWPKNRLMhK-C 674 Pneumocystis murina B123
Q5KJ60              607 AGY--TFPKNELTg--C 619 Cryptococcus neoformans
Q5KHK4              575 AGY--TVPKNSLIdS-C 588 Cryptococcus neoformans
KIS68483            716 GGYggLWPRNKLYpEgC 732 Ustilago maydis 521
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap