1IU3,3SK7


Conserved Protein Domain Family
SeqA

?
pfam03925: SeqA 
SeqA protein C-terminal domain
The binding of SeqA protein to hemimethylated GATC sequences is important in the negative modulation of chromosomal initiation at oriC, and in the formation of SeqA foci necessary for Escherichia coli chromosome segregation. SeqA tetramers are able to aggregate or multimerize in a reversible, concentration-dependent manner. Apart from its function in the control of DNA replication, SeqA may also be a specific transcription factor.
Statistics
?
PSSM-Id: 397833
Aligned: 38 rows
Threshold Bit Score: 149.287
Threshold Setting Gi: 505277333
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1IU3_C          6 AMRELLLSDEYAEQKRAVNRFMLLLSTLYSLDAQAFAEATESLHGRTRVYFAADEQTLLKNGNQ--------TKPKHVPG 77 
Q485E3         91 TVFNFINKEELAMQRGAVGRFLLILAALYRAHPDQFGVVT-DISGRDRLYFANSENKLAESGSS--------TKPRQIPE 161 Colwellia psyc...
WP_013051313   75 DFSQCIDTEELAAQKGAVGRFLFILEAVYRAAPEQFSQVL-KIQGRDRLYFATSKASLLKASKS--------ANPKEIGQ 145 Shewanella vio...
jgi:Shew_1921  67 DPETLIDKGALAQQKGAVGRFLFTLEAIYKATPNQFDQVL-QIQGRDRLYFATSKESLLKASKS--------ANPKEIGN 137 Shewanella loi...
Q8EEP2         74 DFHQLVDEHKLEQQKGAVGRFLFLLESLYQLNKTQFAQIL-QIQGRDRLYFARSREELLKASAT--------ANPKEIGQ 144 Shewanella one...
Q082Q5         99 DFDAMVSQHLLSQQKGAVGRFMYLLSSLESTAGSDFDKVL-NVQGKGRLYFARSKQALLNSSKS--------SNPKEIAS 169 Shewanella fri...
Q12MQ7        138 DFNALVNEHLLSQQKGAVGRFMWLLEGLAALAPSQFNKVL-LVQGKGRLYFARSKDELLASSAS--------ANPKEIGT 208 Shewanella den...
A1S6A5         80 DFSDLLSEAGLAAQKGAVGRFLYALECLHQAAPSRFEQVL-QIQGRDRLYFATSKEALLKASQS--------ANPKEIGS 150 Shewanella ama...
Q3IGV1         88 NVFNVLNKEELAMQKGVVGRFLFILSAFYRTHKTDFRAVL-DIKGRDRVYFATSKEDLVNSGSS--------MNPKNITD 158 Pseudoalteromo...
A1STA5         89 GVNALFDSEVFKTEAVVTNKFMMLLATMYYENKNAFEDAADKTKGRTRDYLGQNLNALLAADSEeeqnffkaSKPRNIPH 168 Psychromonas i...
1IU3_C         78 TPYWVITNTNTGRKCSMIEHIMQSMQFPAELIEKVCGT 115
Q485E3        162 SPFWVITNSNTTRKKMMLTKASISLGYSDSDVEKIREL 199 Colwellia psychrerythraea 34H
WP_013051313  146 SGFWVTTNNNTAKKRNILTEVLQQYGTVEAQIETITNN 183 Shewanella violacea
jgi:Shew_1921 138 SGFWVTTNNNTAKKRTILSEVLGQFGVQEKQIESIIGH 175 Shewanella loihica PV-4
Q8EEP2        145 TGFWVTTNNNTAKKRAILAEALVQFGCDAEIANGIAER 182 Shewanella oneidensis MR-1
Q082Q5        170 SGFWVTTNNNTAKKQTILTEVLEHLGCDSERAKSIAEH 207 Shewanella frigidimarina NCIMB 400
Q12MQ7        209 TGYWVTTNNNTAKKQAILVEVLTKLHCDETLASAIADR 246 Shewanella denitrificans OS217
A1S6A5        151 SGFWVTTNNNTAKKRTILEEALVQLGCDPVRAKslgel 188 Shewanella amazonensis SB2B
Q3IGV1        159 SEYWVMTNSNTTRKKMMLHEVALCLGYSTEQAEKIRDY 196 Pseudoalteromonas haloplanktis TAC125
A1STA5        169 TPFWVITNANTGRKRIIITQMMASMGYPHYLIERIKEE 206 Psychromonas ingrahamii 37
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap