4OM2,4OM3


Conserved Protein Domain Family
TLE_N

?
pfam03920: TLE_N 
Groucho/TLE N-terminal Q-rich domain
The N-terminal domain of the Grouch/TLE co-repressor proteins are involved in oligomerization.
Statistics
?
PSSM-Id: 397828
Aligned: 33 rows
Threshold Bit Score: 140.987
Threshold Setting Gi: 0
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
4OM2_A               16 TPHQaAGQPFKFTIPESLDRIKEEFQFLQAQYHSLKLECEKLASEKTEMQRHYVMYYEMSYGLNIEMHK----------Q 85  
CDS41447              6 QNVGsQQNQIKFSVPDACDRIKDELSYLQQQCHTLKVECERLTQEKTELHRIYMVYYELAYGLNVEIHKqvnvffhrslQ 85   Echinoc...
CDS42131              7 PVPSgPGQSYKFTVVETCERIKDEFNFVQQQCHQLQTEREKLLSERVDMQRICVVYYEMANGLNLEMHR----------Q 76   Echinoc...
XP_015789626          8 GPPQpGQGGFKFSVNETCDRIKDEFAYLQNQYHTLKLELEKLATEKTDMQRHYVMYYEMSYGLNVEMHK----------Q 77   two-spo...
XP_015793393          8 GPPQ-PGQGRGFSINETLERIKDEFGYLQNQYHALRMDLEKLNAEKTDMQRHYVMYYEMSYGLNVEMHK----------Q 76   two-spo...
EFX74134             12 GPPPpPGQ-LKFTVSDTCDRIKEEFNFLQA-H--LKLECEKLASEKTEMQRHYVMYYEMSYGLNVEMHK----------Q 77   common ...
WGS:AAPU:GI24695-PB  11 AGGPpPQGPIKFTIADTLERIKEEFNFLQAQYHSIKLECEKLANEKTEMQRHYVMYYEMSYGLNVEMHK----------Q 80   Drosoph...
EFN89780             20 ggSGgAAGGLKFTVADTCDRIKEEFSFIQSQYHTLKMECEKLANEKTEMQRHYVMYYEMSYGLNVEMHK----------Q 89   Jerdon'...
XP_019696084         33 VPPQ-PGQPIKFTVLESCDRIKQEFDYLQQQNNTLKMECDKLASEKMEIQRHYVMYYEMSYGLNMEIQK----------H 101  Jerdon'...
XP_318239            18 GPPQ-SAQPFKFTITENCDRIKEEFNFLQAQYHNLKMECEKLAQDKTEMQRHYVMYYEMSYGLNVEMHK----------Q 86   Anophel...
4OM2_A               86 TEIAKRLNTICAQVIPFLSQEHQQQVAQAVERAKQVTMAELNAIIG-QQQLQAQHL 140 
CDS41447             86 TEISKRLGAIIAQVLPYLPQEHQAQVAAAVERAKQVTLPELNNLIS-QHQLlfaga 140  Echinococcus multilocularis
CDS42131             77 MEISKRLNAILNQVIPFLATEAQMEDSKLAKFANGGNMGLSNDQLEiYKQIQAHQM 132  Echinococcus multilocularis
XP_015789626         78 TEIAKRLNAIIGQILPFLNAEHQQQVAQAADRAKQVTMPELNAIIG-QQHTGITHL 132  two-spotted spider mite
XP_015793393         77 TEIAKRLNTIIAQIMPYLPPDHQPSVAQAVERAKTVTMTELNQIIGqQQQTGMTHf 132  two-spotted spider mite
EFX74134             78 TEIAKRLNAIIAQVLPFLSAEHQQQVATAVERAKQVTMTELNAIIG--QQMHAQQL 131  common water flea
WGS:AAPU:GI24695-PB  81 TEIAKRLNTLINQLLPFLQADHQQQVLQAVERAKQVTMQELNLIIG--QQIHAQQv 134  Drosophila mojavensis
EFN89780             90 TEIAKRLNAIIAQVMPFLAQEHQQQVANAVERAKQVTMSELNAIIGqQQQQGLQQL 145  Jerdon's jumping ant
XP_019696084        102 SEISKRLNTIIAQMLPFLPHDHQQQIITAIERAKQVSMADLNSVIT-QQRPEIPQL 156  Jerdon's jumping ant
XP_318239            87 TEISKRLNAIITQIVPFLSQEHQQQVLTAVERAKQITMSELNSVIG-QQQRpdlpr 141  Anopheles gambiae str. PEST
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap