Conserved Protein Domain Family
AIP3

?
pfam03915: AIP3 
Actin interacting protein 3
Statistics
?
PSSM-Id: 397823
Aligned: 91 rows
Threshold Bit Score: 346.439
Threshold Setting Gi: 891585872
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
KDE09798             740 FLQIGREVKKARLVEE-PTIASLKLVFVERFQYNPGANDFPA-----IYVRDGEFGISYELEDMKDVRNGSVLSLN---- 809  Microb...
EPB85501             397 FLQIGKEVQKVKYNGE-ISIPALNMLFLEKFSYSVGQNDFPK-----IYIQDPAVGVSYELVDLSEVRDKSMLSFNindk 470  Mucor ...
EIE75760             302 FLQIGKQVKKTIYQGE-LSMSALNMLFVENFNYSSRQNDFPN-----IYIRDPTIGVSYELTDMNEIKNKSVLSLHideq 375  Rhizop...
EKD04427             500 YLQLGRQVKKTAIDLP-TDMSTLKLLFMERFEYDPGMEDFPN-----VYIRDNKTGVQYELEDLKDLQEGSVLTLD---- 569  Tricho...
Q5K9A7               642 FLQIGRKTKRHVLELP-ITLEALKLVFMERFEYDPGKEDFPD-----VYIRD-RDGMEYELEGVEDLREGCTLCLN---- 710  Crypto...
XP_018230676         352 FLQFGSQIKKVIHDKD-ITLDNLRILFTEKFQFTLDNNSFPP-----FYIQDIHTKILYELEDMQDIKDHSLISLK---- 421  Pneumo...
WGS:AFWA:PNEG_02476  357 FLQYGSQVKKVTHSKD-ISLNGIRALFIEKFEFNPCNDNFPP-----LYIQDDRTRIFYELEDAQDITDRSLISLK---- 426  Pneumo...
XP_002175713         403 FIRWSNITKKIPMPSElHTPGEVYNVFKASFH------DIPDdealiFEIRDEETQINYLLEDLSEVKNGSLLVAVqk-- 474  Schizo...
O13735               793 FLRYNNQTRKVKVESPlSNANELGELFSNVYKISFSGDSY-E-----LNIEDPDTKISYLLEDLSDLKYKSLVSFMfkeq 866  Schizo...
XP_013022886         601 FLKLNNRTRKAISPFAvDTQEKLQALFQSKFENEFEDVPF-E-----FYIEDYDTKVNYLLEDYSDMKFKSLIIAQkqlk 674  Schizo...
KDE09798             810 -----------------------------ID----TVEQVKQ---------------HIDQGLLTL--------SQDIKE 833  Microb...
EPB85501             471 edqkesqkewlsevttafnkelsetrrmfTE----QMDEIKK---------------QIVESNARNqeadeekeRSLIQQ 531  Mucor ...
EIE75760             376 eeqresqkelmsalsdlfrkelketsqilMN----QIEEMKK---------------QFGLFNETI-----------IRE 425  Rhizop...
EKD04427             570 -----------------------------IE----PLDQVKQ---------------HFDLTFASL--------SAEIKE 593  Tricho...
Q5K9A7               711 -----------------------------IE----PLDQVKL---------------HIDSTFATL--------VQEMKE 734  Crypto...
XP_018230676         422 -----------------------------IQ----AEDTSKK---------------ILEEELSSL--------TKEFQS 445  Pneumo...
WGS:AFWA:PNEG_02476  427 -----------------------------IQ------DVPNK---------------ALEDGISSL--------TKELQS 448  Pneumo...
XP_002175713         475 ---------------------------pdVEqedePVKEVEPe--------------PVKQENPEVte----mlMKKLEE 509  Schizo...
O13735               867 d-----------------------ankkrEDfhsgEVSAIQHssaqn------tlddHVNTTTHESpssafteiLERLKA 917  Schizo...
XP_013022886         675 v------------------------------peesPVDNVEAvgeatrpyeifskddGINNSsif------eeiLQRLNV 718  Schizo...
KDE09798             834 LRSTMtamrrvssha-----------------------gmfspelatPAAAQTLPEPSEQQYQDAAQKVLrmRRlgsipn 890  Microb...
EPB85501             532 VTTHI------------------------------------------LNQHQQLKPQPADDESKQKEEEKemAPepeast 569  Mucor ...
EIE75760             426 ITTEIlnd------------------------------------lnnSRQPKDDQPQRNKQEQPQEASTQkvDP------ 463  Rhizop...
EKD04427             594 LKSALtqpkrlstaqpltnsllsv----spsqprlplgtpdqtmvinSSPRSPEVEISTPTAPDA--------------- 654  Tricho...
Q5K9A7               735 LRQALdkerettkrlsvlaspsvagdpasltpstsplqppasaislpAPTPLVVGPSEDH-------------------- 794  Crypto...
XP_018230676         446 LKTSI------------------------------------------EGQKEMISEMTSRPSTCLSKSTIesFSkqe--- 480  Pneumo...
WGS:AFWA:PNEG_02476  449 LKTSF------------------------------------------EGQREMISEMASRPSTCVSKVTLesISrhe--- 483  Pneumo...
XP_002175713         510 IEDKI------------------------------------------SQLKLAPAPAAEKESQPTVRVSSdgTS------ 541  Schizo...
O13735               918 IEQNI------------------------------------------STNHTNDSAALKSSEDHSKLANNfsVP------ 949  Schizo...
XP_013022886         719 IERKL------------------------------------------GSEHITNATIQSSSASKTAKSDKvvTN------ 750  Schizo...
KDE09798             891 maasanadkaspsdpntpkpsqastssvgapplpaapkgsptlstsskmgggggkgaldanqvVETLRTQHKQVQDLRRE 970  Microb...
EPB85501             570 spmp-------------------------------------------------vvenagpiisKEQFEAQRKEIETLRRD 600  Mucor ...
EIE75760             464 ----------------------------------------------------------------EQWKKQFLEIENLKRD 479  Rhizop...
EKD04427             655 -----------------------------------------------------------------NLRAHYDEVQSLRRD 669  Tricho...
Q5K9A7               795 ---------------------------------------------------------------LKQIQEQHEELESLRRE 811  Crypto...
XP_018230676         481 ------------------------------------------------------------ttiLKIQKSCPYIIKNIREE 500  Pneumo...
WGS:AFWA:PNEG_02476  484 ------------------------------------------------------------nifLRTQKNHSDIVKNIRQE 503  Pneumo...
XP_002175713         542 ----------------------------------------------------------------SQLAWYHQEVKAAKLE 557  Schizo...
O13735               950 ---------------------------------------------------------------DSIDHKFYQQVKNMQLE 966  Schizo...
XP_013022886         751 -------------------------------------------------------------------ATNYQQVKNMQLD 763  Schizo...
KDE09798             971 LGVLRQVYSDFGHHTKHIFAAMKVETS-RVH-------KLASTSKv-GKSRTFVEAGVQKLDADVSELVVKVDEISDSIE 1041 Microb...
EPB85501             601 VAVLRQLERELREGAASVISEIKEKAE-KVKeeaikkaDAELNQT--STARSHLEEGKKNLLEKSDKVTSRLEDLQDTID 677  Mucor ...
EIE75760             480 IVVLRQLDHESKEEANQMIEEIKMKATtIVNs-----sIKKDSQI--SSARFILEEGKKSLLEKSDKITNRLEDLQDTID 552  Rhizop...
EKD04427             670 LAIMRQLHLDFINQTKESFSTLREQNT-AMR-------EVVKTKM--GGSRALLDNSKSKLEAQCQDTIQSVEEVSDIID 739  Tricho...
Q5K9A7               812 LAITRQSHAEHINESSAIISSLKDEIA-QIK-------KVTSTNP--NSNRGLVDRSKAELDTQCTETIKAVEDITDIVD 881  Crypto...
XP_018230676         501 LETLRNIYTKFASSIKTSMLDIEAKAK-KVK-------EVTIKKL--GGSRDFIELGKKKLETETQSLVTRIENLSDLVG 570  Pneumo...
WGS:AFWA:PNEG_02476  504 LDSLRTIYTDFTLSMKSSMMNIDSKAK-KVK-------NVVFGKL--GGSRHFIELGKKKLEVETQSLVTKIENLSDIVS 573  Pneumo...
XP_002175713         558 LVAVKQSLISMLARVPLKFEEFKNKVL-DIY---------GSTNNntVLERTFINKSKLKLESNLANIVSNFDDLNDLVE 627  Schizo...
O13735               967 LASLKQISAAFFTRIPLKIKDFKKEIN-AFN---------EKGSLdfQFGRGFVLSSKDRIEREVKNVVEKFDEVNDQIE 1036 Schizo...
XP_013022886         764 LASLKQVFAASFTKIPLQLNEFRKQMG-IIN----------EKASgfGFDRGYILKSKDTIEAVAKSLVERFDDINDQIE 832  Schizo...
KDE09798            1042 LMRADVV-RGVRPRPGYLSETALTLKKIVEQRDAVAEKLGTTKPTWAHTWSEELAKVLGEQETVQKHESMLVDLCDDLND 1120 Microb...
EPB85501             678 QLKLDVTqRKCRPSEAQMTHCANERKALAEEIEEFGKYIAQVKPRWKKTWEMELQTIVKEQQTLKDQEYLLSDMKDDLDA 757  Mucor ...
EIE75760             553 QLKLDVTqRKCRPSEIQMKHCAKERKELSKEIEEFDMFIAQVKPKWKKTWEYELQTIVKEQQALKDQEYLLTDIKDDLEA 632  Rhizop...
EKD04427             740 GAREDALrRGITPSKSKMGKIREDLTKATALVETFTTDVAAAEPTWRATWLTELQRVTEEQRLLAYQNKLAADLKNDIKD 819  Tricho...
Q5K9A7               882 AARIDAYkRFVTPSKQQMATIQSDLQKARQLVEDFTSAVKIADPTWRGTWQTELHRVMEEQKLLHHQTKLCGDLKKDLED 961  Crypto...
XP_018230676         571 NLRVDVInKKTRPSSQQFDDIRKEEAQIQKDMISLISHLENLSPCWRQLWETELQNVVEEQEFLTHQEGFIEDLKSDISA 650  Pneumo...
WGS:AFWA:PNEG_02476  574 SLRIDVInRKVRPLPQQLDDVRKKEAQIQKDMISLINHLQSLSPCWRQLWEMELQNVVEEQEFLAHQENFIEDLKADIVS 653  Pneumo...
XP_002175713         628 CLRADVLhRKVRPGLDQVAALRKDKKLLAKEIEDLEATLNSVTPSWKKQWETELNQIVQEQEFLNNQSEMILDLKRDLDS 707  Schizo...
O13735              1037 LMRSDVLlRKVRPGLDQTSQLNEESAYLEKRIQTLERSLEEVTPIWKKQWERELNAIVQEQEFLDSHTVLISDLKRDLSA 1116 Schizo...
XP_013022886         833 LLRSDVLlRKVRPGLDQISYLVKEKESIESSIHELQKAIEEVTPTWKKQWEKELNAIVQEQEFLDNHTNLITDLNKDLDS 912  Schizo...
KDE09798            1121 VKDVLKNIEAVAKSTKKLHR-TKSRhrlaGSGDDGTegndldpgQSLSNVLLEVKHLQPDANRRLEAIARAEKQREIDNA 1199 Microb...
EPB85501             758 LLEVFEQLEKIYAYQANARP--QPRefrvAPAEEGF--------EGMSSVFKQVSTIDVDHTRRLRALEQAEKMRQRELA 827  Mucor ...
EIE75760             633 LSEVFEQLEKIYAYQVSAKP--IVRefrvTPVEEGF--------EGMASVLKQVATIDVDHERRLRAMEQADKMRQRELA 702  Rhizop...
EKD04427             820 ATEMLDNVQAFVDQRKAGGR-ANQNrfmpSSPDEGG--------GGITNLLMEIRTKEADPSQRLRAIEEQQRARERELA 890  Tricho...
Q5K9A7               962 AESMLGNVQTFVEQRVAGTR--TARirvgADAEVEG--------GGISSLLMEIRTKDSDPEQRLRAIEAQQRARARERA 1031 Crypto...
XP_018230676         651 TMDIFANIVTYYEYKEKRIHrss----hsITTQDSI--------SSSNTHHSEARNTKLE-NIRNNSIEKEGKHKETNFV 717  Pneumo...
WGS:AFWA:PNEG_02476  654 TMEIFGNIVTYSEYQEKNAHln-----ysLLKQGST--------DSLNTLNLEARNAKPELEIRANTIPKIEK-QENNFR 719  Pneumo...
XP_002175713         708 VSTVLANVTAIAEYQNQTPLeSKPLqlltASNLDVG--------EYRNRINLEITKLKPDSESRLEAIRRAEALRKKNLS 779  Schizo...
O13735              1117 LSTVLSNVSAIAELQAKSSIkSKPLtlktATESEIK--------GYRDQIQLEVLNLKPDSEARLQAIERSELLQKKRLL 1188 Schizo...
XP_013022886         913 ITTVLSNVSAIAELQAKSSIkSKPLavkpSAG-DMK--------EIREKIHMDVLKLRPDSDVRLQAIERFEAFQRKKVL 983  Schizo...
KDE09798            1200 NRTDEFADELEEFVQRGKLKKSGGVEEAERLRQARS 1235 Microbotryum lychnidis-dioicae p1A1 Lamole
EPB85501             828 NRIDDFEKELVGFVETKKLKKTGGAMEIDRLRKQKD 863  Mucor circinelloides f. circinelloides 1006PhL
EIE75760             703 NRTDDFERELVSFVNTKKLKKTGGALEIDRLRKQKD 738  Rhizopus delemar RA 99-880
EKD04427             891 TRTDEFQNELSGFVAGKKLKKTGGTDEAERVRQRRQ 926  Trichosporon asahii var. asahii CBS 8904
Q5K9A7              1032 NKVDEFEAELKGFVGGKRLKKTGGAEEVDRLRGRKD 1067 Cryptococcus neoformans
XP_018230676         718 FHIDKFKNELNEFITNVKFKKTGCMNDIERFREEKD 753  Pneumocystis jirovecii RU7
WGS:AFWA:PNEG_02476  720 FYIDKFKYELDEFLSKTKFKNVGCMDEVERIRKEKD 755  Pneumocystis murina B123
XP_002175713         780 LMEDKFKAELEEFVKEDKFHKIGGIEEVNRLRELKD 815  Schizosaccharomyces japonicus yFS275
O13735              1189 QRVDEFSKEVKTFVENEKLNKIGGAEEADRIRTIQD 1224 Schizosaccharomyces pombe 972h-
XP_013022886         984 FHEDEFAKELKEFIKDDNLRNIGGVEEVERRRSVQD 1019 Schizosaccharomyces cryophilus OY26
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap