Conserved Protein Domain Family
Sec20

?
pfam03908: Sec20 
Sec20
Sec20 is a membrane glycoprotein associated with secretory pathway.
Statistics
?
PSSM-Id: 112708
View PSSM: pfam03908
Aligned: 6 rows
Threshold Bit Score: 98.2627
Threshold Setting Gi: 93141310
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
Q12981   133 QTSSTITESLMGISRMMAQQVQQSEEAMQSLVTSSRTILDANEEFKSMSGTIQLGRKLITKYNRRELTDKLLIFLALALF 212 human
Q9VNI9   135 SQENDVTEKMLAISRHLSETTQKSAITLETLVASSQNVEATSDELHHTAGSISMSGKLLKKYGRRECTDKMLLFFAFSLF 214 fruit fly
EFH61898 143 SDAESITESLRRSRQLMVQEVERSTNTLVAFDESTGVLKKAESEYKGHRSLLSRTRNLLSTMQRQDVIDRIILIVGFSLF 222 Arabidopsis lyrata ...
P28791   204 SKTKQLTNNLVRGNQILQSGILQSDLNLDELRAQTNSLTQIDDKYTQFETVFKKTADLVKVLENASHQEKRDVYLSLGFL 283 Saccharomyces cerev...
KHC73395 148 SQNKQITKSLQASRQLLSAGILQSELNIDNIDQQTKDLYKLNEGFIQFNDLLNRSKKIVKFIEKQDKADRQRIYLSMGFF 227 Candida albicans SC...
O42852   122 TSASQVTAAMRDIHAQMVQAVDMSAENAMELSSSTNLLETLQEKYFGVEDVLYTSKRIIKSLKLSDRSDYFLVVSGFGFF 201 Schizosaccharomyces...
Q12981   213 LATVLYIVKKRL 224 human
Q9VNI9   215 LACVFYIVQKRL 226 fruit fly
EFH61898 223 VFAVVYVVSKRI 234 Arabidopsis lyrata subsp. lyrata
P28791   284 LCCVSWVLWRRI 295 Saccharomyces cerevisiae S288C
KHC73395 228 ILCCSWVVYRRI 239 Candida albicans SC5314
O42852   202 IFVVVYLLFKRI 213 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap