Conserved Protein Domain Family
TRAP_alpha

?
pfam03896: TRAP_alpha 
Translocon-associated protein (TRAP), alpha subunit
The alpha-subunit of the TRAP complex (TRAP alpha) is a single-spanning membrane protein of the endoplasmic reticulum (ER) which is found in proximity of nascent polypeptide chains translocating across the membrane.
Statistics
?
PSSM-Id: 397813
Aligned: 20 rows
Threshold Bit Score: 338.981
Threshold Setting Gi: 1133465538
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
XP_002022614   8 MLMVLPIVICTF-SAPNK--FGAYAAEA----VEDDl---------VDVDS--EEGAVTGEDAD---------ADEDTDK 60  Drosophila pers...
EFA00653       8 SLLVFPAVIFTL-DNGLK--MVAHAEEDp---LEDE----------VEVEGeaDVEEVAPTDA----------EDEEDSE 61  red flour beetle
XP_015790503  11 LLLLIPLNLF----SPTIsfQGVDAADQk---NEPNag-------sDSVEG--EDEAAVEEDAGgdalvsgtgEDEDDSL 74  two-spotted spi...
XP_002746293  11 LLLVFPATVLLRgGPRGS----LAVAQDl---TEDEet-------vEDSIIedEDDEAEVEEDEptdlaedkeEEDvs-- 74  white-tufted-ea...
XP_015220433  12 LLLAFPCSLI---GSVGRvsAESEPPGDg----------------tADSVVdeEEEEDDEEALVeethisddsGDEQDDP 72  spotted gar
XP_019214354  12 FLLAFPCGL----ISVGHvyADSDSAEDi---VEDSda-------aVDe----EEDDEDVLVEEdqiqtsdgdEDDSDEA 73  Nile tilapia
CAF96840      52 FLVAFPCGL----VSVGHvaADADSAEDv---ADDPea-------aVDe---eEDDEEDVLVEEdqmrsterdDEDTDET 114 spotted green p...
XP_019853353  15 SLFLTPLLSLSG-PSLALadDAVVGEDDevmsVDDEegeddenvvlPDAG---EARESGGDGAGsee---eeeEEEEEED 87  Amphimedon quee...
XP_028430979  12 lllAFPCGLISI----GQvsADSDSAEDi---AEDPda-------aVDe----EEDDEEVLVEEdqiqpsegeEEDSDEA 73  yellow perch
XP_014342296     --------------------------------------------------------------------------------     coelacanth
XP_002022614  61 ---ESSASPNADTYLLFTkplytpgQQLDLPGGKPVEFLIGFTNKGAEEFVIETVEASFRYPMDFNYFIQNFSAVAYNRE 137 Drosophila pers...
EFA00653      62 ---KTTASPDADTTLLFVrpi-ataSQLELPAGVPVEFLVGFRNKGKEDFVLESLEASFRYPMDFNFYIQNFSAIGYSKV 137 red flour beetle
XP_015790503  75 ---SLKPSPDVDTYFMFTkp---agKGLELPANSDAHFLVGFANRGQKDFIVESMGASFRYAMDFNFHIQNFSAIPYNKV 148 two-spotted spi...
XP_002746293  75 --gEPEASPSADTTILFV-------KGEDFPANNIVKFLVGFTNKGTEDFIVESLDASFRYPQDYQFYIQNFTALPLNTV 145 white-tufted-ea...
XP_015220433  73 veaTVTSHPDVDTTIIFV-------SGEEFPANEIVKFLVGFTNKGSQDFTVQSLEASFRYPQDYQFYIQNFTVLPLSTL 145 spotted gar
XP_019214354  74 adkLLASHPDADTTIIFT-------TGEEFPANEIVRFLVGFSNKGSQEFTVQSLEASFRYPQDFQFFIQNFTALPLNTV 146 Nile tilapia
CAF96840     115 dekTLSSHPDADTTIIFV-------TGEEFPANEIVKFLVGFTNKGSQDFTVRSLEASFRYPQDFQFYIQNFTALPLDTV 187 spotted green p...
XP_019853353  88 ---LYKPSPDAKTDIIFTn-----rAENNFLAGQIVKSLIGFSNNGNENFIVTSVEASFRYPQDFSYFIQNFSKVYYDAY 159 Amphimedon quee...
XP_028430979  74 adkLLTSHPDADTTILFM-------TGEEFPANEIVRFLVGFTNKGGQDFTVQSLEASFRYPQDFQFYIQNFTALPLSTV 146 yellow perch
XP_014342296   1 ------------------malspsfslADFPANEIVRFLVGFTNKGSEEFLVKSLDASFRYPQDFQFYIQNFTALPLNTL 62  coelacanth
XP_002022614 138 VKPGFESTVSYTFLPSDQFAGRPFGLNIALAYRDANGIQYNEAVFNETVLISEVDEGLDGETFFLYVLLAGIVVLLLVIG 217 Drosophila pers...
EFA00653     138 VQPEQEATLAYSFIPSEAFAGRPFGLNINLAYRDASGNSFQEAVYNETVQIIELEEGLDGETFFLYVFLVAGVVLLLVIG 217 red flour beetle
XP_015790503 149 IKPNEETTLAYSFFISEAYSTRPYGFTVELHYKDKDGNQFMNAVFNETVSIVEVDEGLDGETIFLYIFLIALVGLLAFGA 228 two-spotted spi...
XP_002746293 146 VPPQRQATFEYSFIPAEPMGGRPFGLVINLNYKDLNGNVFQDAVFNQTVTVIEREDGLDGETIFMYMFLAGLGLLVIVGL 225 white-tufted-ea...
XP_015220433 146 VQPQRQASFEYSFIPALPMAGRPFGLVILLNYQDSEGNVFQSAIFNQTVTITELEEGLDGETVFMYVFLSGLVALILFGL 225 spotted gar
XP_019214354 147 VKPQAQASFEYSFIPAQPMAGRPFGLVILLNYQDTEGSVFQTAVYNQTVTITEREEGLDGETMFMYVFLAGLVSLLLFGM 226 Nile tilapia
CAF96840     188 VQPKAQASFEYSFIPAQPMAGRPFGLVILLNYLDSEGGVFQTAVYNQTVTITETEEGLDGETMFMYIFLGGLVVLMLFGM 267 spotted green p...
XP_019853353 160 VPPSHQASFTYDFTPSESFYSRPFGLVVNVYYKTEEGNEFRDAVFNGTVNIVEIEEEFDAESFFMYVLMISGVCLLMFII 239 Amphimedon quee...
XP_028430979 147 VQPQSQASFEYSFIPAQPMAGRPFGLVILLNYLDTEGNVFQTAIYNQTVTIIELEEGLDGETMFMYIFLVGLVALMLFGI 226 yellow perch
XP_014342296  63 VPPEKQASFEYSFILAEQMAGRPFGLVINLHYKDSNGNVFQNSVFNQTVMIREADEGLDGETVFMYVFLFAVVVLMLFGL 142 coelacanth
XP_002022614 218 QQYlLGSSGKR-KRA-Aak-kvIETGTA-ND-STIDYDWVPQETLRALQKSppkskTPKtspkpgkqaspkaashQSPKQ 292 Drosophila pers...
EFA00653     218 QQT-LLSFGKK-RITrKaa--pVETGTS-NP-NNVDYDWLPKQTLATLNKEks-qkSPKsi-------------kQSPRQ 277 red flour beetle
XP_015790503 229 QQL-FFSMSKK-RISaPka--kVEVGTV-ST-TDVDYDWLPPETLSAINK------SPRn--------------kASPRQ 282 two-spotted spi...
XP_002746293 226 HQL-LESRKRK-RPIqK-----VEMGTS-SQ-NDVDMSWIPQETLNQINKA-----SPR----------------RLPRK 275 white-tufted-ea...
XP_015220433 226 YQV-LESRTRK-RVPgK-----VETGTG-GL-NDVDISWIPQETLNVMNKA-----SPK----------------ASPRK 275 spotted gar
XP_019214354 227 YQV-LDSRTKK-RLSvK-----IEKGTA-GI-NDVDISWIPQETLNVMNKA-----SPK----------------ASPRK 276 Nile tilapia
CAF96840     268 YQV-LETRTRK-RIPlK-----VEKGTG-GM-NDVDISWIPQETLNAMNKA-----SPK----------------ASPRK 317 spotted green p...
XP_019853353 240 HFV-WTTVKRGgRAApKkraapVERGTTkNKrSQVDESWLPEGTI---QKK-----SPRk--------------pTSPRN 296 Amphimedon quee...
XP_028430979 227 YQV-LETRTKK-RIPvK-----IEKGTG-GM-NDVDISWIPQETLNVMNKA-----SPK----------------ASPRK 276 yellow perch
XP_014342296 143 YQV-LETRTRR-RAVqK-----METGTA-SH-GDVDLSWLPRETLNMINKV-----SPK----------------PSPRK 192 coelacanth
XP_002022614 293 RKVKRSAGDD 302 Drosophila persimilis
EFA00653     278 RKVKRSTGSE 287 red flour beetle
XP_015790503 283 RKVKRGTGSs 292 two-spotted spider mite
XP_002746293 276 RAQKRSVGSD 285 white-tufted-ear marmoset
XP_015220433 276 RT-KRAAGTD 284 spotted gar
XP_019214354 277 RT-KRAAGTD 285 Nile tilapia
CAF96840     318 RA-KRAAGRD 326 spotted green pufferfish
XP_019853353 297 RQKTTsnntl 306 Amphimedon queenslandica
XP_028430979 277 RT-NRAAGAD 285 yellow perch
XP_014342296 193 RT-KRTAGVD 201 coelacanth
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap