2QUP,2P61


Conserved Protein Domain Family
DUF327

?
pfam03885: DUF327 
Click on image for an interactive view with Cn3D
Protein of unknown function (DUF327)
The proteins in this family are around 140-170 residues in length. The proteins contain many conserved residues. with the most conserved motifs found in the central and C-terminal region. The function of these proteins is unknown.
Statistics
?
PSSM-Id: 397804
Aligned: 96 rows
Threshold Bit Score: 77.2144
Threshold Setting Gi: 81342803
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
2QUP_A                  11 LHRVDSkkqQ-TA--------AGVSFSEVMGKQRDE--KAYER---------------------LQALMSKIDDQGKLLS 58  Bacil...
SLUandSVAtrep:TPE_0795  29 KNQNKKleeTsKR--------KPKSFLNTILDSAQK--DSSETdyearlkglssgerkaviddiLADLQDKVYSSGSNLA 98  Trepo...
jgi:Glov_1375           13 RKGHQPlasTpPKp------gLFSLFSSELQAKQLEvnQHEQT---------------------ISDLRAALDTAGEALE 65  Geoba...
jgi:Ppro_0708           13 EHKTTKtgnLkRS--------STRTFTTELAQKENEynDYKRE---------------------VDELKQEIDEAGDRLE 63  Pelob...
Q74CJ0                  13 DKKGKQeslSrSDv-------AGSPFVRTLTRNRSEfeNYEQE---------------------LQVLKDELDKVGNELE 64  Geoba...
Q39V75                  13 GKKAGKgalVrTGgg-----eANSPFVRALTLHRTEldTYEQQ---------------------LQDLKEEIDRAGTDLE 66  Geoba...
WP_011940473            13 DKRTKGaalRkAAd------sGSSLFAKKLGQMSKDsaDYAGQ---------------------LQALKEEIDRAGDSLE 65  Geoba...
ACH37674                13 AKKGKGtpaKsVAg------sSGQLFAGRLTAIAKSgtEYEGE---------------------LKRLKEEIDKAGEVLE 65  Geoba...
O51260                   8 AGALNLnskDyKKsgkkvsfdKNNLFSSIFQAESVK--EDKHFilleng---------efnldlIKSMLDGINETGERLL 76  Lyme ...
Q73RH6                  21 iakdshiqknqtrktentkvkKQKTFLDTILDSNIQ--ESEESyyekkleglnpeerkkavddiLAVLQDEVYSSGANLA 98  Trepo...
2QUP_A                  59 ETRTIEELRKYKELVKEFVGDAVELGLRLEERRGFNRRG-RTKIYKIVKEVDRKLLDLTDAVLAKEKKGLDILNMVGEIK 137 Bacil...
SLUandSVAtrep:TPE_0795  99 DNINTDTISEYKKAVKTFVNFAVKHSLDVKSIISGGLNPiKQRNYTIVKIIDEKVERLTKELLFNQLEKLQILEKLDEIK 178 Trepo...
jgi:Glov_1375           66 KEPTIQNFRRFRELLSKLAKQVSNEAYRLEKIGGTPM---NPRYYEIITVIDKEADKLYELVVKEQKDRMSITASVIGIK 142 Geoba...
jgi:Ppro_0708           64 REPNLDNLHRFRNLLGQIAKRISAEAYRLNKINGTPQ---NPRYYEIITVINVEADQLYKLLLDEQRNHMAITEKIIGIK 140 Pelob...
Q74CJ0                  65 REPTIANFRTFRDLIGRITKNVTSHAYRLQRVGGTTL---NPRCFEIITVIDREADNLYRLIMTENKDRLAITNKILELK 141 Geoba...
Q39V75                  67 REPTVANFRTFRDLIATLAKTVTSNAYRLERVGGTSL---NPRCFEIITVIDREADNLLNLIMTENKDRLKITNKIMELK 143 Geoba...
WP_011940473            66 KEPTIVNFKIYRDLISAFANKVTSDAYRLELVGGPN----SQRCHEIITVIDKEADELYHLIMKEQKNHIKITAQIMKIK 141 Geoba...
ACH37674                66 QEPTIANFKVFRELIGTMARKVTAEAYRVELLSGGV----TGRAHEVISVIDKEADLLYHLVMREQKDHIRIVSQIIKIK 141 Geoba...
O51260                  77 SEPSRQNVIFYKKVISEFISIIISSSVCLKEQKGGNLGDpKRPKYRIIKIINDKLDKLAYSVLQNQMTQIKLLDSIEEIQ 156 Lyme ...
Q73RH6                  99 ENVNEETINKYKKAVKSFVNFALQHSLNVKAVTSGGLNPlKQRNYVIVKVIDEKIDKLTQELLFNQLEKLQILAKLDEIK 178 Trepo...
2QUP_A                 138 GLLINIY 144 Bacillus halodurans
SLUandSVAtrep:TPE_0795 179 GLLINLT 185 Treponema pedis str. T A4
jgi:Glov_1375          143 GLVVDLV 149 Geobacter lovleyi SZ
jgi:Ppro_0708          141 GLVVDLT 147 Pelobacter propionicus DSM 2379
Q74CJ0                 142 GLVVDLK 148 Geobacter sulfurreducens
Q39V75                 144 GLIVDFL 150 Geobacter metallireducens GS-15
WP_011940473           142 GMVVDFM 148 Geobacter uraniireducens
ACH37674               142 GLVVDFL 148 Geobacter bemidjiensis Bem
O51260                 157 GLLVNLL 163 Lyme disease spirochete
Q73RH6                 179 GLLVNLT 185 Treponema denticola
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap