1T98


Conserved Protein Domain Family
KicB

?
pfam03882: KicB 
Click on image for an interactive view with Cn3D
MukF winged-helix domain
The kicA and kicB genes are found upstream of mukB. It has been suggested that the kicB gene encodes a killing factor and the kicA gene codes for a protein that suppresses the killing function of the kicB gene product. It was also demonstrated that KicA and KicB can function as a post-segregational killing system, when the genes are transferred from the E. coli chromosome onto a plasmid.
Statistics
?
PSSM-Id: 397801
Aligned: 11 rows
Threshold Bit Score: 193.412
Threshold Setting Gi: 237500483
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1T98_B           3 EFSQT-----VPELVAWARKNDFSISLPVDRLSFLLAVATLNGERLDGEXSEGELVDAFRHVSDAFEQTSETIGVRANNA 77  Escherichia coli
B8F3P6           4 ELAQT-----IPELILWTKEREFSLSLSSDRLAFLLAIALYNNERTDGELLESDLQDIFRHVSNAFEQSEATQTQRANNA 78  Glaesserella ...
P45185           3 ETSQT-----IPELVSWAKDREFSLNLPTERLVFLLAIAIYNNERLDGEMLEADLVDIFRHTMNAFEQSTDAIATRANNA 77  Haemophilus i...
Q7N6B9           3 EYSQT-----VPELVSWARKNDFSISLPVERLAFLMAIAVLNSERLDGEMSESELVDAFREVCKGFEQTTESVAVRANNA 77  Photorhabdus ...
Q9KRC6           3 EFTQDtvqkpIDELVTWVKQYDFSLNLPTERLAFLLAIAVLSNERFDEELGEGELHDAFAIVTRLFAESGEASAFRANNA 82  Vibrio choler...
ACQ68427         3 EISQS-----IPERVSWVRQNHFAIMLPPDRLAFLVAIATLNIERLDGEISEGELIDIFYLANKDVAQAHENLLIRANNA 77  Candidatus Ha...
IBRC:GU3_10560  29 EMSRT-----LPDWIGWVREENLGLSLPPDRLAFLLAVHIFGRGGEQPQLSEAELHHAFGYVSKGFEQAADTQTSRANNA 103 Oceanimonas s...
WP_011706221     3 STSRT-----LPEMVGWVRQEGLALSLPTDRLAFLIAIKTLSEDESD--LSEAALHDAFGYVSNAFGQMDETLTGRANNA 75  Aeromonas hyd...
jgi:Tola_1461    6 rperS-----LPELVGWVKQEQLELHLGNERLAFLIAISSMARDEQTQELSEATLHDAFSYVSQLYGLMDETLTVRANNA 80  Tolumonas aue...
Q6LPL3           3 EVSQT-----VPELVTWVKQHDFSLNLPTERLAFLLAIAVLSGDRFDEELGEGELIDAFRIVSDLFDQSKETLAFRANNA 77  Photobacteriu...
Q5E0E6           8 vTDQT-----VDELVGWVKQHDFSLNLPTERLAFLLAIAVLSNERFDDELGEGELHDAFGIISGLFGQSSDTIAFRANNA 82  Aliivibrio fi...
1T98_B          78 INDXVRQRLLNRFTSEQAEGNAIYRLTPLGIGITDYYIRQ 117 Escherichia coli
B8F3P6          79 INDLVKQRFLNRFSSEFTEGLAIYRLTPLGVGVSEYYIRQ 118 Glaesserella parasuis SH0165
P45185          78 INELVKQRLLNRFSSEFTEGLAIYRLTPLGVGVSDYYIRQ 117 Haemophilus influenzae Rd KW20
Q7N6B9          78 INDMVRQKLLNRFTSELADNNAIYRLTPLGMGISDYYIRQ 117 Photorhabdus laumondii subsp. laumondii TTO1
Q9KRC6          83 INDLVKQRLLSRFTSEMTEGASIYRLTPLAIGITDYYVRH 122 Vibrio cholerae O1 biovar El Tor str. N16961
ACQ68427        78 INDMVDQRLLNRFTTQQAEDYAIYRLTLLGIGITDYYIRQ 117 Candidatus Hamiltonella defensa 5AT (Acyrthosiphon pi...
IBRC:GU3_10560 104 INDLVRQRLLSRFQGDGGEGESLYRLTRLGLAIVEFFAAQ 143 Oceanimonas sp. GK1
WP_011706221    76 INDLIRQQLLSRFNTDMVAGESLYRLSRLGMSIVDFFMDQ 115 Aeromonas hydrophila
jgi:Tola_1461   81 INELVRQRLLSRFNTDPVAGESVYRLTRLAIGIIEFYLDQ 120 Tolumonas auensis DSM 9187
Q6LPL3          78 INELVRQRLITRFTSEVNDGASIYRLSPLALGITDYYVRQ 117 Photobacterium profundum
Q5E0E6          83 INELVKQRLISRFSGESTDGMNIYRLTPLAIGITDYYVRH 122 Aliivibrio fischeri ES114
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap