3JR1


Conserved Protein Domain Family
Fructosamin_kin

?
pfam03881: Fructosamin_kin 
Fructosamine kinase
This family includes eukaryotic fructosamine-3-kinase enzymes. The family also includes bacterial members that have not been characterized but probably have a similar or identical function.
Statistics
?
PSSM-Id: 397800
Aligned: 26 rows
Threshold Bit Score: 336.129
Threshold Setting Gi: 121740753
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3JR1_A        21 WKSISQVLAEQFGAYYFIKHKEKLYSGEXNEIWLIN-DEVQTVFVKINERSYRSXFRAEADQLALLAKTNSINVPLVYGI 99 
Q7NGJ6         2 WTAIARHIAQSTGEAFAAEGRSAVGGGSINRTCVLS-GSGRRYFVKLNTPDTLAMFEAEADGLEALHRAGALRVPRPICS 80  Gloeobacter vio...
Q03SE8         2 MMLTSDWLQQLPLPK--ITAITPVAGGDINQAYQLI-TVEGPVFLLVQPHTSAQFYHHEVAGLQAL--GQAVNVPDVLAT 76  Lactobacillus b...
Q04DT3         2 FNLTKAFLKEVPTNA-EVTDFHEVHGGDINKAYSLTdAQGGRYFLKVQPNSVLAFFQHEADGLKLL--GQAARVPKVIAL 78  Oenococcus oeni...
Q9LEW8        34 SEDPIREWILTEGKATQITKIGSVGGGCINLASHYQ-TDAGSFFVKTNRSIGPAMFEGEALGLEAMYETRTIRVPNPHKA 112 thale cress
P74594         9 WQTIAQQISQTTGQPFRIQERRSVSGGCINQGYCLV-DGEQKYFVKLNQAQQWQMFQAEALGLEAMAATQTIRVPRPICH 87  Synechocystis s...
Q110F1         2 WKKIAEHITQVTVENFEVTDHCLVGGGCINTAYKLT-DGTRSYFVKINQASLVEMFRAEALGLEEMWETQTIRVPKPFCY 80  Trichodesmium e...
WP_009543899   2 WTQISEHISQATGKSFTIESQKSVSGGCINQGYCLI-GEDTKYFVKINHASQVEMFTAEALGLKEMAETQTIRVPKPICW 80  Crocosphaera su...
Q31LQ4         8 WSAIAAVINTQRDRPSLIQQAQPVGGGCINRSYRLVlEDGQAWFVKLNQRDSLAAFAAEAEALTAIAASQTIRVPQPIAW 87  Synechococcus e...
Q82TM9        13 WATVAAQISRHTGQTFAPESLTPIGGGCINQTFCIR-DHERQYFVKLNKAGNLAMFESEAAGLGEILDSASLRVPQPLCC 91  Nitrosomonas eu...
3JR1_A       100 GNS-QGHSFLLLEALNKSk-nKQSSFTIFAEKIAQLHQ-IQGPDKYGLDFDTWLGPIYQPNDWQTSWAKFFSENRIGWQL 176
Q7NGJ6        81 GVA-ADSAYLVIEWLPLG---GRGDWEQLGEQLARLHR-TISSKGFGWRRDNTIGSTPQPNPWTADWAAFFARHRIGHQL 155 Gloeobacter vio...
Q03SE8        77 GEI-EGDAYLVLEFLETG----HGSQYDLGQAVARVHR--VTAPRFGFDTDNLVGKLPKHNQWQSDWTTFYLQQRLDPLV 149 Lactobacillus b...
Q04DT3        79 GHV-GQDQWLLLEYLNAT---NYGNQYSLGQDLAKIHSiTSPNGQFGFDKDFKAGKTSKINTWQSSWYEFFVKQRLNVLR 154 Oenococcus oeni...
Q9LEW8       113 GELpTGGSYIIMEFIDFGg--SRGNQAELGRKLAEMHKaGKTSKGFGFEVDNTIGSTPQINTWSSDWIEFYGEKRLGYQL 190 thale cress
P74594        88 GSS-AGHSYLVLEWLEFGr-gNHDSWYRMGQNLAALHQ-AGGSAQFGWQTDNTIGATPQPNPWTDSWADFFAEHRLGYQL 164 Synechocystis s...
Q110F1        81 GTE-GNNCYIVLEWLELGdrgNDKSWENMGQNLAALHR-HQGKSEFGWAHNNTIGSTPQINSWCGDWAEFWVQHRIGYQL 158 Trichodesmium e...
WP_009543899  81 GMT-ERSSYIVLEWLEFGr-sSKDSWDLMGRNLANMHQ-YQGQSKFGWSQNNTIGSTPQVNNWTEKWSDFFADHRIGFQL 157 Crocosphaera su...
Q31LQ4        88 GET-NRSAYLVLEWLELDr--GPTDWRQMGAQLAQLHRqTRSPQGFGWHRDNVIGQTPQINPWQWDWGAFWQVQRIQFQL 164 Synechococcus e...
Q82TM9        92 GSH-HDDAWLVLEFIDLQ---NRGNAAALGIGLANMHR--HTAETFGWIRDNTIGSTPQRNATASDWISFWRQHRLGYQL 165 Nitrosomonas eu...
3JR1_A       177 QICKEKGL-I---FGNIDLIVQIVADTLSKHNPKPSILHGNLWIENCIQVDD-K-IFVCNPACYWGDRECDIAFSSLFEP 250
Q7NGJ6       156 ALARGSAI-D---RATAQELVERIPNLLAGHCPEPSLLHGDLWLGNADFTAA-GePVIFDPATYYGDRETDLAMSELFDG 230 Gloeobacter vio...
Q03SE8       150 RRAQEQHLwTpqrQAAYDQVRQRIITENHGRFIQPALLHGDLWSGNYLFTQD-GtPTLIDPDVLYGDREFDLAMTTIFGG 228 Lactobacillus b...
Q04DT3       155 ELLINEGKwNd--DQNYKKAIEIFQSLMEKHDSRPSLLHGDFWSGNFMFDADsGqPIFIDPDVYYGDPEFDIGITTVFGG 232 Oenococcus oeni...
Q9LEW8       191 KLARDQYG-DsaiYQKGHTLIQNMAPLFENVVIEPCLLHGDLWSGNIAYDKN-NePVILDPACYYGHNEADFGMS-WCAG 267 thale cress
P74594       165 ALARRRAG-N---FPDPAVVVPKVKQLLGDRQPTPALVHGDLWSGNGAILTT-GePVILDPATYYGDGEVDLAMTELFGG 239 Synechocystis s...
Q110F1       159 KLAKGRGV-S---FSGGDRLLKIIPELLAGHQPQPSLVHGDLWGGNASFTVD-GePIIFDPATYWGDREVDLAMTELFGG 233 Trichodesmium e...
WP_009543899 158 KLASRKGG-N---FGNYSQIVEKVRDILSTIHPQPSLVHGDLWSGNAAVTEA-GePVILDPATYYGDREVDIAMTELFGG 232 Crocosphaera su...
Q31LQ4       165 DLAARNGY-R---WPHAQALCDRIPDLLADHQPKPALVHGDLWSGNASFLAD-GtPVIFDPATYYGDREVDLAMTELFGG 239 Synechococcus e...
Q82TM9       166 NLARKNGH-TgslQSLGERLLSEFQHFFTDTLPLPSLLHGDLWGGNYAFDQD-GqPVIFDPAVYYGDREADLAMTELFGG 243 Nitrosomonas eu...
3JR1_A       251 FPTNFYQRYNEIYPLEEGYLERKLIYQLYYLLNFSYRYynkKQSYVSLTQKLINQILHK 309
Q7NGJ6       231 FPESFYRGYRRAWPLAPGYERRKVLYNLYHVLNHYNLF---GGGYASQANRMIRQLLIQ 286 Gloeobacter violaceus
Q03SE8       229 FTSDFYRGYQDSYPLTPGYADRLPHYQLYYLLAHLNLF---GETYGDA----VDNVLAR 280 Lactobacillus brevis ATCC 367
Q04DT3       233 FNQDFYVGYQSTKPFQSGAERRLMFYQLYYLMVHAHLF---AGSYIQAYRGKLAQIIQQ 288 Oenococcus oeni PSU-1
Q9LEW8       268 FGESFYNAYFKVMPKQAGYEKRRDLYLLYHYLNHYNLF---GSGYRSSAMSIIDDYLRM 323 thale cress
P74594       240 FPAAFYQGYHSISPAEPGYQQRKILYNLYHILNHFNLF---GGGYQQQAQQMLKQCLRI 295 Synechocystis sp. PCC 6803 substr. K...
Q110F1       234 FPTAFYRGYNEAWPLDNGYKHRKALYNLYHILNHFNLF---GGGYASQAEIMIQQLLAK 289 Trichodesmium erythraeum IMS101
WP_009543899 233 FPAPFYRGYNEVFPLDEGYKKRKTLYNLYHILNHYNLF---GGGYGSQANYMIQEVLKs 288 Crocosphaera subtropica
Q31LQ4       240 FPPAFYEGYRQVWPLDPGYRSRRDLYNLYHVLNHVNLF---GGGYVHQAQRLIDRLLAt 295 Synechococcus elongatus PCC 7942
Q82TM9       244 FPPDFQAAYRDTWPVETGYTTRKQLYNLYHILNHLNLF---GPQYLSQAEITMKKLLAE 299 Nitrosomonas europaea
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap