3H0G,6A5R


Conserved Protein Domain Family
RNA_pol_Rpb5_N

?
pfam03871: RNA_pol_Rpb5_N 
Click on image for an interactive view with Cn3D
RNA polymerase Rpb5, N-terminal domain
Rpb5 has a bipartite structure which includes a eukaryote-specific N-terminal domain and a C-terminal domain resembling the archaeal RNAP subunit H. The N-terminal domain is involved in DNA binding and is part of the jaw module in the RNA pol II structure. This module is important for positioning the downstream DNA.
Statistics
?
PSSM-Id: 397791
Aligned: 131 rows
Threshold Bit Score: 63.7026
Threshold Setting Gi: 134068988
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3H0G_Q         7 NIVRVFRAWKTAHQLVHDRGYGVSQAELDLTLDQFKAMHCGMGRnldRTTLSFYAKpSNDSNKGTIYIEFAKEPSVGIKE 86  Schizosaccharom...
XP_006364435  29 ESHRYFLARRTILEMLKDRGFAIPNSEIDTTLQEFREKYGQTPD---VERLRVSAM-HRNDLTNKVLVIFCGPNAVKVNV 104 potato
XP_009116415  33 ESHRYYLARRNALEMLRDRGYEVSLEDINLSLQDFRTVYGERPD---VDRLRISAH-HRSDSSNKVKVVFFGTGKVKVNT 108 field mustard
Q9ZVB9        20 ECHKYYLARRTTMEMLRDRGYDVSDEDINLSLQQFRALYGEHPD---VDLLRISAK-HRFDSSKKISVVFCGTGIVKVNA 95  thale cress
KRH66799      38 ESHRYYLSRRTTLEMLKDRGYSIPSHEIDLSLSDFRDMHGQFPD---PDRLRLSLT-HATNSSKRILVIFCGPGVVKVTA 113 soybean
XP_002529165  40 ETHRYYLSRRTVLEMLRDRGYSVPSSEIDLSLQEFRAIHGPNPD---IDRLKFSAT-HTSDPSKRMLVLFGGPGIIKVST 115 castor bean
XP_013632337  37 ESKRFYLARTTALEMLRDRGYQVSDAELSLSLSEFRSGFGEKPD---LERLRISVP-LRSNPMKKILVVFMGSEPVTVKT 112 Brassica olerac...
XP_002297750  35 QSYRYYISRRTVLEMLKDRGYDVLDSELNRSLTEFRSVFGNSPD---LDSLRFSVS-LRSIPHKKTLVMFLGTDEIKTAN 110 black cottonwood
EEF49580      41 ESQRYYLSRKTVMEMLRDRGYDVADSELTGSFTEFLSEFGDNPD---ILKLRISAS-LHSHPDKKMVVVFMGTEEIKLAN 116 castor bean
XP_002269723 136 ESYRYYLSRRTLFQMLSDRGYNVPHSELTRSLSDFRASFGHNPD---PSRLRICLP-LISSPSKKILVVFCGTDEIRKAV 211 wine grape
3H0G_Q        87 MRTFVHTL 94  Schizosaccharomyces pombe 972h-
XP_006364435 105 IRSILTQI 112 potato
XP_009116415 109 IRSVAAei 116 field mustard
Q9ZVB9        96 MRVIAAdv 103 thale cress
KRH66799     114 IRNIAGQi 121 soybean
XP_002529165 116 IRAIAGQi 123 castor bean
XP_013632337 113 VRAIHSQV 120 Brassica oleracea var. oleracea
XP_002297750 111 IRTVYGQi 118 black cottonwood
EEF49580     117 IRGLLCQi 124 castor bean
XP_002269723 212 IRVIFQQI 219 wine grape
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap