1MNT,1QTG,3QOQ


Conserved Protein Domain Family
Arc

?
pfam03869: Arc 
Click on image for an interactive view with Cn3D
Arc-like DNA binding domain
Arc repressor act by he cooperative binding of two Arc repressor dimers to a 21-base-pair operator site. Each Arc dimer uses an antiparallel beta-sheet to recognize bases in the major groove.
Statistics
?
PSSM-Id: 397789
Aligned: 3 rows
Threshold Bit Score: 73.7939
Threshold Setting Gi: 375332369
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
1MNT_A  1 ARDDPHFNFRMPMEVREKLKFRAEANGRSMNSELLQIVQDALSKPSPVTG 50  Salmonella virus P22
1QTG_B  4 MSKMPQFLNRWPREVLDLVRKVAEENGRSVNSEIYQRVMESFKKEGRIGA 53  Salmonella virus P22
3QOQ_A 16 SRTADKFVVRLPEGXREQIAEVARSHHRSXNSEIIARLEQSLLQEGALQD 65  Pseudomonas aeruginosa
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap