3NJT


Conserved Protein Domain Family
ShlB

?
pfam03865: ShlB 
Click on image for an interactive view with Cn3D
Haemolysin secretion/activation protein ShlB/FhaC/HecB
This family represents a group of sequences that are related to ShlB from Serratia marcescens. ShlB is an outer membrane protein pore involved in the Type Vb or Two-partner secretion system where it is functions to secrete and activate the haemolysin ShlA. The activation of ShlA occurs during secretion when ShlB imposes a conformational change in the inactive haemolysin to form the active protein.
Statistics
?
PSSM-Id: 397786
Aligned: 101 rows
Threshold Bit Score: 248.252
Threshold Setting Gi: 691224644
Created: 11-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
PubMed ReferencesClick to see Conserved Features Help

Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
3NJT_A       209 GYSYLDLQLQRRALPRVSLGMDNSgpgtpENGRYKYNASVTANDLLGLNDTLGLYIGNRYYRdAGHDAERNYDLMYSVPL 288 Bordetella pert...
CAR44119     207 GGSVIKLSNQRKSPWHLNIASDNYgq--kNSGRWLIRTNASLDSPLGLSDFVSLNANITTDN-PNTRFNRAYTLLYSIPY 283 Proteus mirabil...
Q7N9K7       209 GGSVIKLHNQRSKPWLLNIKTDNYgq--kSTGKWRVRTNTSFDSPFGLSDFISLNASSTLDS-PSNRYSRAYTLLYSMPY 285 Photorhabdus la...
WP_012986872 209 GGSVIRLSNQHSTPWRISTITDNYgq--kSTGKWISRLNASMDSPLGLSDFISLSGISTVDN-PDTQYNRAATLFYSLPY 285 Xenorhabdus bov...
WP_013185719 209 GGSIIKLYNQHTSPWRITTTTDNYgq--kNTGKWINRLSASIDSPLGLSDFISLSGSSTIDK-PNTQYNRAYTLLYSIPY 285 Xenorhabdus nem...
CDG19452     209 GGSIVKLHNQHASPWRITTTTDNYgq--kNTGKWITRLNASVDSPLGLSDFVSLSGVTTVDK-PATQYNRAYTLFYSLPY 285 Xenorhabdus dou...
WP_045957422 216 GGSIVRLHNRHSSPWKITTTTDNYgq--kSTGKWITRLNASVDSPLGLSDFVSLTGSSTIDK-PDTQYQRAYTLIYSLPY 292 Xenorhabdus poi...
Q0WAT7       213 GGSILKLHNTPSTPWHLTTSMDNYgn--kNTGKWLSRNALSFDNPLGLSDSVSINISNTVDR-PQHNYSRAYSMFYSVPY 289 Yersinia pestis
ACR68201     211 GGSVIRLYNRRGRPWQVSGSLDNYgq--qSTGEWVARGSATLDSPLGLSDFVSLSASTTLAA-PSARYSRAYMLFYSLPY 287 Edwardsiella ic...
WP_004237648 215 GGSVIRLVNQRGTPAGFSISADNYgq--kSTGRNVIRAAVTADSPAGLSDFVSLSGSATTDN-PAARYSRSGMLFYSVPY 291 Morganella morg...
3NJT_A       289 GRTRLDLQTGYSTYRNLLKTRYGQYQSAGNSRSFGLKATRLLYRDTRSQFSVYGGLKLRQNKNYLAGTRLDVSSKHYSDV 368 Bordetella pert...
CAR44119     284 GGFTFSSFGSYSEYQFHQKLQTRTVSLYGDTTQVGIRGDYAFSRSQKQIDTLNIQVTHKRIRNYFSQIRLDLSSPKLTTI 363 Proteus mirabil...
Q7N9K7       286 GAATFSGFGSYSQYASRPHLQMRTIKIYGDTQQIGMRSDFAFYRNQSQINSVSGQLTYKNYNNYIDNAKIGVSSQTLSVF 365 Photorhabdus la...
WP_012986872 286 GAATFSGFTSYSRYISHPKLQHNVHKLYGNSQQSGMRMDWVFHRNQSQISTLNTQLVYKNFNNYFDSAKLSHSSQTLTVF 365 Xenorhabdus bov...
WP_013185719 286 GSLTFSGFNSYSQYTSHPHLNLNRVELHGNSQQTGIRTDWVFHRSQSQISTLNTQLIYKDYNNYFNESRIGVSSQTLSIF 365 Xenorhabdus nem...
CDG19452     286 GAITFSGFNSYSQYTGHPRLQVTQVKLHGNSRQTGVRADWVFHRNQSQISTLNSQLVYKHYNSYFGESKTGVNSQTLSIL 365 Xenorhabdus dou...
WP_045957422 293 GAMTFSGFNSYSQYTSHPHLHITSVKLNGNSQQTGLRTDWVFHRNQTQISTLNSQFVYKNYRNYFIDRKVSINSQTLSVL 372 Xenorhabdus poi...
Q0WAT7       290 GALTFSGFGSYAEYRYPMKLQFNTAKLHGETQQHGLRADYVFYRDQSQINGLSAQLTYKRASNYLNEEKIAISSPTLTIF 369 Yersinia pestis
ACR68201     288 GDLTFSGFASFSDYQMHQSLPHTRILLDGQASQYGLRGDAVLQRSQRQINTLGVQLTYKRIRSYLQDDLLRVSSPTLSVA 367 Edwardsiella ic...
WP_004237648 292 GALTISTYGSLSRYRITQALRYNHVILSGDSAQAALRADYVIFRNRSRIDSLMAQMTYKRSRNYLNDTLIGVSSPSLSIA 371 Morganella morg...
3NJT_A       369 TVGMQYSTQRGANAYFGDLSFTRGVGVNNgkyaaydERGPQG---------NVSRFNGSLAWTRYMAlAGQP-IQWASQL 438 Bordetella pert...
CAR44119     364 ELGINHLQIIPNGVLSTNLSVEKAVGWFG-------AEETPYitngngndyRFTKVKLFANWYQRFS-LWRStFLFNSTF 435 Proteus mirabil...
Q7N9K7       366 ELGVNHLHIIPTGLITLNLSVEQGLPWFG-------AQTGTAyl-----dkQFTKGKLMVNLHQRFM-LFNSpYQLNNLF 432 Photorhabdus la...
WP_012986872 366 SLGISHLQIIANGLITFDAGIEQGTPWFS-------AQTSTDnl-----nkQFTKGKLSVNLQQRFR-LFDMsYRLNNQF 432 Xenorhabdus bov...
WP_013185719 366 ELGISHLQLIPAGIISLDIGIAQGMPWFS-------NQTATShl-----ntTFTKGKFSANWQQRFK-FLDTsYQFNSQF 432 Xenorhabdus nem...
CDG19452     366 ELGVTHLHILPSGLFSLNMGIERGMPWFG-------AQTETGnl-----nkQFTKGKLSANLQQRFT-LFEVpYRFNSQF 432 Xenorhabdus dou...
WP_045957422 373 ELGMNHLQLIPSGLITVNISVEKGMPWFD-------AETATAdl-----nkRFTKGKLSANLQQRFT-LLSIpYRLNSQF 439 Xenorhabdus poi...
Q0WAT7       370 ELGLNHLHVLPMGLFNINVSLEQGLPWLG-------AERSNGplan-yqdsQFTKAKTSITSNHYFA-LFDDtYLFSNQF 440 Yersinia pestis
ACR68201     368 ELGFSHLHILPGGVATGNLSVERGLSILG-------ADRGRLrtg---aeaQYTKLKLSAGLNQRVT-LADDvYLFSSQW 436 Edwardsiella ic...
WP_004237648 372 EAGYTGLILVPGGVISTSLSAEKGTTLFG-------AATRNTmpg---sdpQYTKGKFSLSYIQQFS-LSEDaYLFSSHL 440 Morganella morg...
3NJT_A       439 GFQYSRQQLLNSYQITVGDEYTVAGYnlRTSQSGDSGVYLSNTLTVPvqfsllgkQASVAPFVGADVGALKSnhPDARTi 518 Bordetella pert...
CAR44119     436 LGQYSHDTLPGVEWLSLTDKNAIRGFd-QSTLSGDNGGYLRNTLSYPyr----lnHFSITPRIGVDIGQVKQhgNYKGWq 510 Proteus mirabil...
Q7N9K7       433 YGQYNRHGLPGVEWLNITDRNAVRGFs-KNTLSGDNGWYLQNTLSRTfp----laNSTLSMRIGIDTGRVQGyrSPQGWq 507 Photorhabdus la...
WP_012986872 433 YTQYSPNGLPGVEWLNITDRNAVRGFs-KNTLSGDNGWYLRNTLSHSip----ilKGSLDLRAGVDIGRVKGylSQNGWq 507 Xenorhabdus bov...
WP_013185719 433 HTQYSRDGLPGVEWLTVTDRNAVRGFs-KNVLSGDNGWYLRNTFSHSip----isNASLSLRAGMDIGQTKGyrSQYGKr 507 Xenorhabdus nem...
CDG19452     433 YAQYSQSGLPGVEWLNLADRNAVRGFs-KNVSSADNGWYLRNTLSHSip----iaKGSLSLRTGVDIGQVKGdrSQDGWk 507 Xenorhabdus dou...
WP_045957422 440 YAQYSQSGLPGIEWLNVADRYAVRGIs-KNALSADNGWYWRNTLSHVip----isTGSLSLHTGIDFGQVKGhhSQDGWn 514 Xenorhabdus poi...
Q0WAT7       441 YGQYTRDRLPGVEWLSITDSSAIRGFs-RNTLSADQGWYLQNTLSRRft----lgDATLTPRVGLDTGRLQQk--PQGWv 513 Yersinia pestis
ACR68201     437 YGQYSRDPLPGVEWVSLTERSAVRGFk-RGTLSADNGWYWQNTLSRPlg----wrAFTVTPRIGLDVGRVLSnaGNQGWq 511 Edwardsiella ic...
WP_004237648 441 AGQYTQDHLPGGEWLTLSDNSAIRGFh-DGSLSADKGWYWQNTLSRRfv----rqGITVTPRAGADYGRVMAqtGQAGWq 515 Morganella morg...
3NJT_A       519 rMAGLAAGVRF 529 Bordetella pertussis
CAR44119     511 gGYGLSSGLNI 521 Proteus mirabilis HI4320
Q7N9K7       508 sSAGISSGTTL 518 Photorhabdus laumondii subsp. laumondii
WP_012986872 508 sSAGLSTGLTW 518 Xenorhabdus bovienii
WP_013185719 508 sSAGLSAGLTL 518 Xenorhabdus nematophila
CDG19452     508 sSAGLSAGLTL 518 Xenorhabdus doucetiae
WP_045957422 515 sSIGLSAGLTL 525 Xenorhabdus poinarii
Q0WAT7       514 sAMGLSAGVSL 524 Yersinia pestis
ACR68201     512 sGVGAVVGVTL 522 Edwardsiella ictaluri 93-146
WP_004237648 516 sAAGIAAGVNV 526 Morganella morganii
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap