5OQJ


Conserved Protein Domain Family
Tfb4

?
pfam03850: Tfb4 
Click on image for an interactive view with Cn3D
Transcription factor Tfb4
This family appears to be distantly related to the VWA domain.
Statistics
?
PSSM-Id: 397778
Aligned: 22 rows
Threshold Bit Score: 291.497
Threshold Setting Gi: 75133276
Created: 20-May-2020
Updated: 7-Aug-2020
Structure
?
Program:
Drawing:
Aligned Rows:
Sequence Alignment
?
Format: Row Display: Color Bits: Type Selection:
5OQJ_4           23 PSLLTVIIEIAPKLWTTFDEEgn---ekGSIIKVLEALIVFLNAHLAFNSANKVAVIAAYSQG-IKYLYPXXXxx----- 93  Saccharomyce...
jgi:OSTLU_39977  12 KSLLVVLVETNPRYWAASEGKgdgtaaaNGLSSVLEATTVFLNSFFALNQQNRAAVIAVHDDG-CHYLYTSPL------- 83  Ostreococcus...
Q8LF41           13 VSLLVLLLDTNPLFWSTTS---------ITFSQFLSHVLAFLNAVLGLNQLNQVVVIATGYSS-CDYIYDSSL------- 75  thale cress
Q6Z2N2           11 VSLAVVVVDTNPLFWATAA---------LPFADFFAHLIHYVNSLLLLNHLNHVVVIAAGLSS-CTYIFDSSD------- 73  Japanese rice
Q09645           50 MSTLSVLIETSSCSWGMLASAhg----dRTIGIILRAIVSFCNAHLGQSANNQLLVFAYGRNVdNKMIYSSTR------- 118 Caenorhabdit...
Q16LU5            7 ASLLVIVMDTNPSQRIIRENP-------HHLTQCLDSIVAFANAHLMQKAQNKLAVLACHHHA-TEFLYPTPG------- 71  yellow fever...
Q9VPX4           15 IDLLVIVLDTNPSQHFVRQNP-------QNLTQILEAVIAFGNAHLMQKAQNKLAVVSCSHHA-TNFLYPLPR------- 79  fruit fly
Q561R7            8 LNLLVIIVDTNPIWWGKQALKes----qFTLSKCMDAVMVLANAHLFMNRSNQLAVIASHIQE-SRFLYPGKNgrlg--- 79  Norway rat
EDN02982         19 PSLLTIILDTNPHAWARLEPS-------LPLSAAIANLLVFINAHLACNYANKVAVVASHCHH-AAWLYPTPAspkssds 90  Histoplasma ...
O74366           23 PSLLVVILDANPASWYSLSKK-------VPVSKVLADITVFLNAHLAFHHDNRVAVLASHSDK-VEYLYPSIA------- 87  Schizosaccha...
5OQJ_4           94 ---xxXXXXXXXXXXXXXXXXX-------------XXYRRFRNVDETLVEEIYKLFELEKKQIEQNSQrSTL-AGAMSAG 156 Saccharomyce...
jgi:OSTLU_39977  84 ---------------------------------------ELNAGDASASATGKKRTKTATPSSRAAMS-SPF-AGALSLA 122 Ostreococcus...
Q8LF41           76 --------TSNHGNFESNGTGMp-----------aIFGSLLKKLEEFVTKDEELSKEEVSEDRIPS---CLL-SGSLSMA 132 thale cress
Q6Z2N2           74 --------ASASGAADVAA----------------TFAKASRKMDEFIAEDARATSSNGSVADGNA---ASLlSGALSLA 126 Japanese rice
Q09645          119 --------------------------------------CEDRNASFLVVKRLRELLSSDALTNDATIG-APL-GPALAHA 158 Caenorhabdit...
Q16LU5           72 ------------KPLDIRQVD--------------GQYEAFTLVEKTIKQKLAKVISEAPRLTVPTE--SLL-AGSMAMA 122 yellow fever...
Q9VPX4           80 ------------RQVELRQVD--------------GQYEAFNLVEKTVKQQLGSILMNAPRLSAPCE--SLL-AGSMSMA 130 fruit fly
Q561R7           80 --dffGDPGNALPDCNPSGSKD-------------GKYELLTAANEVIAEEIKDLMTKSDIKGQHTE--TLL-AGSLAKA 141 Norway rat
EDN02982         91 qtdapSKDAPPDGDISMNDQQSagqhqqaeqeeplNKYRPFRLVEEQLTRNLHTLLSTTTAADIASTTsTLI-AGALTLA 169 Histoplasma ...
O74366           88 -------PEQKVAEVDPTKEA--------------NTYRKFREVDDLVLSGMKRLMSSTDKVSRK----TMI-SGALSRA 141 Schizosaccha...
5OQJ_4          157 LTYVNRIsKESV--T----------------------------------------TSLKSRLLVltcgSGSSKDEIFQYI 194 Saccharomyce...
jgi:OSTLU_39977 123 LCYCNRAqTLETaaG----------------------------------------LRVRPRILC----LQASQDNPTDYI 158 Ostreococcus...
Q8LF41          133 LCYIQRVfRSGH-------------------------------------------LHPQPRILC----LQGSPDGPEQYV 165 thale cress
Q6Z2N2          127 LCYIQRVfRSGT-------------------------------------------RHPQPRILC----LQGSPDGPEQYV 159 Japanese rice
Q09645          159 FCHMKKDsRVVTadPcddslgpqt----------------------tseqsetasEKATNRAVV----ISITPIMGSEHG 212 Caenorhabdit...
Q16LU5          123 LCYIARVhRNKPa-----------------------------------------gVKINSRILV----VTGSNECASQYM 157 yellow fever...
Q9VPX4          131 LCYISRLqRNLAp-----------------------------------------gVKMHSRILV----VTGSNECASQYM 165 fruit fly
Q561R7          142 LCYIHRAsKAVKd-----------------------------------------nQEMKSRILV----IKAAEDSALQYM 176 Norway rat
EDN02982        170 LSHINRE-TIAYaeThgtarpdgsstsgpanstasglppppgttasattshlpnpSALQSRILIi--sLSSTTHSAHHYI 246 Histoplasma ...
O74366          142 LAYINQVqn---------------------------------------------kNTLRSRILIf--sLTG--DVALQYI 172 Schizosaccha...
5OQJ_4          195 PIMNCIFSATKMKCPIDVVKIGGskESTFLQQTTDATNGVYLH-VESTEGLIQYLATAMFIDPXXXXXXXXXXXXXXXXX 273 Saccharomyce...
jgi:OSTLU_39977 159 SMMNAIFSAQRQSIPIDAFAL-GehDLPFLQQAAHITRGAYVK-PTHGAGLLQYLLSTAALDMRSRSHLKLPAARGVDFR 236 Ostreococcus...
Q8LF41          166 AVMNSIFSAQRLMVPIDSCYI-GvqNSAFLQQASYITGGVHHT-PKQLDGLFQYLTTIFATDLHSRGFVQLPKPIGVDFR 243 thale cress
Q6Z2N2          160 AVMNSIFSAQRSMVPIDSCIV-GtqDSAFLQQASYITGGVYLK-PQELNGLFQYLAAVFATDLHSRTFLRLPKTLGVDFR 237 Japanese rice
Q09645          213 SLMNLFFSAAKQSICVDVVSMGDdfTGGILQQAADITGGSFLH-AKKPQTLLKILMTNMLTDPTHRAVFSKLSHNSVDYR 291 Caenorhabdit...
Q16LU5          158 TYMNVFFTAQKQNVSLDVCALDK--PLSLLQQGCDITGGQYLK-LPQLDGFLQYLLWVFLPEPLTRCKLVLPPPVKVDYR 234 yellow fever...
Q9VPX4          166 TFMNVFFTAQKLGITIDTCALDK--TLSLLQQGCDITSGQFLK-VTQLDGLLQYLLWVFLPAPQIRHKLVLPPPPKVDYR 242 fruit fly
Q561R7          177 NFMNVIFAAQKQNILIDACVLDS--DSGLLQQACDITGGLYLK-VPQMPSLLQYLLWVFLPDQDQRSQLILPPPIHVDYR 253 Norway rat
EDN02982        247 PIMNSIFACQRLHIPIDILKLAG--DAAFLQQASDATRGIYIPaTSHPAGFLQYLMLGFLPDQRARSHLVLPSRVDVDFR 324 Histoplasma ...
O74366          173 PTMNCIFCAQKKNIPINVCNIEG--GTLFLEQAADATGGIYLK-VDNPKGLLQYLMMSLFPDQNLRKHLNTPNQANVDFR 249 Schizosaccha...
5OQJ_4          274 TSCYLTGRVVAVGFICSVCLCVLSIIp-PGn-----kCPACD 309 Saccharomyces cerevisiae S288C
jgi:OSTLU_39977 237 ASCFCHKRPVSVGFVCSVCLSIFCERrsS--------CDTCG 270 Ostreococcus lucimarinus CCE9901
Q8LF41          244 ASCFCHKKTIDMGYICSVCLSIFCEHhkK--------CSTCG 277 thale cress
Q6Z2N2          238 ASCFCHKKTIDMGYVCSVCLSIFCKYhkK--------CSTCG 271 Japanese rice
Q09645          292 ASCACHHQLVSSGWVCSICLSVLCQYt-PI-------CKVCK 325 Caenorhabditis elegans
Q16LU5          235 AACFCHRELIDIGYVCSVCLSIFCKFs-PI-------CTTCH 268 yellow fever mosquito
Q9VPX4          243 ASCFCHRELIDIGYVCSVCLSVFCKYs-PI-------CTTCH 276 fruit fly
Q561R7          254 AACFCHRSLIEIGYVCSVCLSIFCNFs-PI-------CTTCE 287 Norway rat
EDN02982        325 AACFCHRRVVDVGFVCSICLSIFCEP--LGgvdgvaeCLTCG 364 Histoplasma capsulatum NAm1
O74366          250 ATCFCHKKVLDIGFVCSVCLSIFCEPrvH--------CSTCH 283 Schizosaccharomyces pombe 972h-
| Disclaimer | Privacy statement | Accessibility |
NCBI Home NCBI Search NCBI SiteMap